R3,~ WWw.textWWH .text__B .textgg> .textoor6 .dataww@.data$|@.bssF@^P&&SvFW PHojW}hwhggW؋FlOڣjO؋FfOF hOvTۣnOpOwDjdhhNkgw66hhNowءwڣ*wءwڣwءڣNw*tOjjhwh*hhN,W }3hhNhwh1"ow*hwhHhhNoWwۣh h W}hwhQgg8NM_K~ghh~Wĵotjj*~g-_j=_DDwڢDtWw؃>ڃ~~=vt<-t2vtti1W|vvtthh8No8Nt6hh8N8gj=_DDwڢDtWw؃>ڸ8N~N(WwڢDDwڢFw.t_wDthwtwءP*$WK~ghh~Wĵou Ww(uhwhpA&Ww0t_wBu@tU6B6@hwhqV_F=~7jjv_j=_DDwڢDtW؃>T8ڸw.uw0u wFt wuw6j*~gh__hh~WĵouK~g8Nthh8N8gj=_DDwڢDtWvvoF vNv^:F u FHFVN~33U*WjhhoU츇WjWDDK#Wjjjo'WFt[Fthwhhhz~oFthwhhhz~oFthwhhhz~ojHo3U3.w؃>~.jhhvv0o u9w6 WFFڋFFFvڊ7yuvuvvvtowڣjvvhho v wڣwww؋FwwhWhjoۣWWwjoDDt joDDu3wڣw؋Fv wڣwF~~ehWhsjowۣvoDDFhhĵot wFvv Wwڣ*Wvv Wwڣw|6W6Wjow؃> tvvlohoDDF҉Vԃu~tchhWhwh vvҚo vvҚNWvvҚ:ohhWWF֚(W~~vhwh"o˸wFu6oDDtRjvvhho v |4FFhwhvvou`wvvhwhhhz~o w6oDDw6W6Wjo6joDDF؅ujoDDFօu joDDt:~tj~t&joDDFVjvvFPo j؍FPЍow6oDDFVjFPvv0o u3wڣwu(wuw6oDDwww~avvWF؅}Aw6oDDw6W6Wjo~ufwv t wءv hwhhTw6ohwhhTw6ohwhhTw6ojjw6"oujjw6"o%Pjw6"o}hwh#lowt%w؁hwhhTw6ojvv_)WPowt]ww؃>u3Phwh'Ww؁&w؁&hwhhTw6oWwۣ6W6Wjo35Uw؃>t Pvv_)W3Fw}wtwwtWthwh8hhz~owhWhsjowۣjoDDFhhĵotF,wt W/Ww6oDDF*W~}hhhwhZhhz~o w3 Fw| w؃>} 3FFhwhhTw6o|jjw6"oF|wءF%FF Pjw6"ow jhTw6ohwhhTw6o}vjw6"ojh,"WDDjhh_)WPoDDw؋FhwhhTw6o|fvjw6"o}w} 3˸wuhwhhTw6oF=wFjvvJoF=~\j FPvjoF=}F~ uFPhwhyFPxo F~}FvoFFȤdž\|dž^wwBWoFj/vv0WFVut F@VFVFVvvhwhFPo FP^\hwhhhWov^\hwh`Po(Wh$`PPoF=}Ow؃>u^\lohwh"o^\lo`Po(WovhwhFPo j FPv(ovoDDh$`PoFkwuvhhWhwh"o hhWoF4~} w؃>t~u`Po(W3˸wBtFF=}|hhW`P0ou3wڣBuQhhWWF=~;~~5wjvoF=|Gw؃>t8`Po(WwBtB>UwBt.Wt"(WhhWoW(W3F~~FFw}w؋F wwtwڣw؋FVwtw6oDDu~ t~ t w؋F wtSFV 1ɚoFv WDDF~ tw؃>u3Phwh'Ww؃>Nu w؁^Nu w؁&I>N u!w؁&wء%w !>Nt>Nt>Nu 6NWw؁&&&&&wu wwt~~w؁&F hwhhTw6o}˸w3w}wt9wء;Vu(;Fu#wء;F uwءw;uwtw6oDDuowt^FV 1ɚoFv WDDF~ t%w؃>t>uwt3Phwh'W FF~ t ~ t~ u v WK~ u w؁8~ u!w؁&wء%w ~ u w؁&w؁&& &&~~ &F hwhhTw6o}˸w؋FVw؋F w3~}FFF=xtU~=tCQ=t4~= tF=t~=tFFFFF =t=tMFFx=<t7Fi=xt8=t"=tF LF EFF 9=tF *=t=tF F =tFw؃>~wu~uFF~xuhwhhTw6o|kw؁&F w؁&F w؁&F w؁&F hwhhTw6o|F˸w} wء)hwhhT6o}˸wء%F-}=.FF2FFKFnFFFF,FXFFF` FF%FKFFF#ELY`gnu|vvhwhFPo FVURWwڣHH}˸HwJ3؊622Uhhh6w6joUwHwJw}jhT6o3U3UjjjowDFFwL~}/~u)jjjoFVu ~u3FjoDDtjoDDt3F~~~u~u wڣ3UjWDDvvjowt+wLujjjojjjovvjohWhjowDtDUUhWhjojjjojjjojjjoFFwH~ HFVF~}3˸wtwڣFFwء#Fvv^ F~~;F;F}3wH} WwJ6J؊622F}~} ~uF~~ vv^ ~}FFGw|lFF FDv vvw6(oF;F t8~|7FFF)F ~~ jd"W~ ~ FN~ }F˸fw|qhWhsjowۣjoDDF=}Fhhĵou2jFPw6(o=}D*Wvo˚*WF-~F-Pow؃>uF̚*WvoDD3FFFw}v~ }F ~ t)hWhsjowۣv oDDFhhĵotOFFFwtFwڣF~tw؃>t~~uF%V2;uF~twء#Fvv^F~u!vD2- 2F=~3FH~u~uvD2- 2F*~u$~ukF_vT2 2FFw`tOF%w;bu>FFw;d|2~ t*Whwh hhz~o WF~u~uF@;F|~t~uF%V2;uqF%V2;‹vv^wءtwtvF2PvvWwڣ~ZwFmF H;F~5wH}/wJ6J؊622F|*W~ t*WFvv^$FF;F|Fw}˃~:wH} WwJ6J؊622F=|hWhsjowۣvoDDFhhĵotF/wH} WwJ6J؊622F*W~uF)F~}FvoDD~}Fwء#F w|.~|(~!FFF2hwhlojjhTw6o|FF;F|3Uhy!WUhy!W"hwh# oFVu~t!vvtoFޅt ~މFF~~)~|+FPoDDFV } 3ˍFPoFV|rލFPoFV|ŅrFV+FVnF;F~̋FUjjļoۣjjļo+F=}3ˋFjjļoFVFPovTwu joDDu w9w~13+hwhAhwh/hhz~o hwhJlojhwh&JoF|hwh hTvo|hwh0hTvo|hwhhTvo|voDDwظw؃>|;wtw|>|joDDt wt3˸؊Fww؁&69ؠwڢ:=>hwh0hTjoF=~jjhhzFoFUjoDDu3˚K#W؊Fww؁&$&& 'ؠwڢ(+,hwhhTjoUw؃>| joDDu3˸whwh hTjoUjFPj(oUvv vj(ovvoFvvvj(oF%vv^t4%W}Fvv^4u3Uvv%WjhwhPj(owu5joDDt(wDtDhWhjo3F~~hWhsjowۣvoDDFhhĵotFjFPjjoF*W~'~uTw؃>uHwDt; ~~F2Dؠ˸w؃>uwDujFPjjoF=uUw؋FU~ t vd3vLUwt˸U~FΞowڣN`owڣRJowڣP4owڣTwءNw;PuPwءRw;TuT(WFwPuNwNu wPFUw؃>Tt66TtoDDt' w؃>Ttw6Rto˸w؃>Pt6PoDDu3Fw؃>Ptw6NoDDtNw؃>Ttw6RtoDDtNFU(W(Wv vvJoF(WFF(WF=u Ξow;PtJow;PuU)WF~u `ow;Tt4ow;Tu U)W FFFUwءNjoDDFwut%66jowjjjoUjroPoPHoUv11WDDu8zW~t+~uDjoDDt$hwh@hhz~o3˸8wzihwh[v v ovwۉvuuhwh]lovwu utpv11WDDt~t~u0wz|WvWrSxWhwhdFPo~u~tv|uhwhfFPoFPv v ovwۉvut ~ujjvFo|WvWrSxWvwut3v11WDD=} 3˃~u|W~ 0WFFFwutvl9WDDF\vuzt/vuztv| >w33룸~u ~uvvoF= uhwhtvvotQFPoDDFVu~tvvvvoFF,hwh~hhz~oa3ˋvNv^.u vXFhhvvovv ~u~t~wu~tvu N6WFVFFFFvveMWFVvu FFFFvvotzFFFF*v7ytvPoDDvFvuvveMWFVvu FFFFvvou3hwh oFVu~tFV˸wFFjdvvVov11WDD} 3˃~t~t~t~ u3F=t@)Wuhwhv vovwۉtt땍FPouowڣtFFwU)Wt jHovoDDjoDDjhwhJo})joDDvBoDD=tjoDDvBoDD=tvoDDhwh oFVuL~uF)WPΙoDDFVu~t vtuFFFFvTDFVFVFVFV>ue~tavoDDhwhvBovwۉv|WvWrSxW_voDDhwhvBovwۉvzWrWrOtWvFvD@DBwvDDvDFDHwvDJvDLDNwvDPvDRDTwvDVvDXDZwwءvD\T^3vD vD Dw&xFPvvotwwˍFPoFމVvދD F=d}Fl~|́~'vD| vރ| ~wvD| vރ|~wvD| vރ|~ wyvD| vރ|;~ w]vދF=|~;~FvvtttD@PvhwhhhxohhxoF=~ x<Fv D uv | t v t | tv t | :tv t |:tF#v^ w _7yuF~|FEv^ w _7yuvF^ w _7yuiF~|oFFv^ w _v6DF~|FPtoFu Fdu F򙻐u3FF-m1ɚ\oFVF-؋F-md+؋F-A؋ÙFVFFv^ w _FvF^ w _FFPtoFF=u=u= u,= u9=u~}7~;~.FFVFPoڃDt n^F~}[FPvvotFFȋFFʋFމFċFFƋF=u=tFV;V~|;Fr3~}~ ~vw؋FV~ua~XFVM~|J~DFFV-Q\oFVL~|~F*~|~;~˸ءrrFVF<1ɚ\oFVFFPvvouF FFFUv v vvhwhhhJohhJNW3Uv v vvhwh hwh hhJohhJNW3FFw66oFvvoFFFvv ^ t4:oFwء;FvoDDFVu ~uvvw66hwh vvovvj6WFFFFFF< t ~ tvFFvvi1Wu=tnvvoF@PoDDFVu~t|hhvvovv ^ FFDFF;F~ DvFFzW|؋6rWrWtW2r.WF=t$FFvv:ojl9WDDw؋FFFF3FFFvtijoDDFVu ~u33vDD~u~uFFFFvFDFDFFFFFFVvvv^FF~}vt,)Wwڣhwh$ outLPoPoutŶDw;u_(outNPoPoutŶDw;uPDw6ΙoDDuu w33Ŷt4hh o v<~tFVvvhhouvvoFFvv^vڈFF;F}vv^zW|/fF~}v6rWtW%;Ft 3˸F"ؠFؠFF-F=\~ ~`}F\~\~wxuF\wءLV+ЉV~\~n؃>tguVOXOw| gt(؋6Fu{zW|؋6rWrWtW2r.WF})D~ukw2^؃VOXOFFwء$ F>u w| tw؋FVF| Fw+D3Fw+ڣDFFvvuw| ؃>twX gt(؋6FuNAzW|؋6rWrWtW2r.WF}؃VOXOwء$#FFFFFFF3FFFFw\tzwu~ t2F:Fu*uwXX=^}!>X^u7w؃>X~)XX FX^O`OwXwt~ tw~tPwx tCwPtwءNvF$wؠvFvOFwx w twؠvFvMv FF F$2FFttw~tXwx uChUWDDF=u wPuFNwx Pt wءNFFFkwPu\w~tOwx tBjUWDDF=u wPuFOwx Pt wءNFw~t~t ~t~uFPF2wv twؠFF4@Fwؠ2;FuFw\twءZ;Fu wؠFwPtwءN;Fu wؠFFtwؠvFvFFFFFFFtwؠvFvFFFtwءZvFvFFFtwءNvFFtwؠvFvFFw؃>XtXFFFFFFFFW~t1w2#Fw+ڣDvءDNvvFFFV;Vwr;FrދFw+;F FFFFFFFw+;F|>F+ڣDvFw+;F~XF| FwFFFF؃>8FFvvuFw+ڣDv؊F؊Fgw0wwgwظLwڣJwwRwN&wPwv wVYwtwڣwww63wڣ4wڣ26Mww<w w,t wء:w6Bw6@JWwڣ<wءwڣw$w(hjգWDDF=|.jFWDDF=|Ww6$vWDDF=}F˸wwx 3UwhFP!#Wjjvvhwh j~gwtGjjhwh hwh j~gBODOvv(pWmWRPWjjhwh hwh U츇^O`OJOLO33һۣFOHOwڣROTO33һۣNOPOۣZO\Ow؃>tNNw03wڣ*w.3wڣ,w2w6w4BODOwءڣghwtwNuLt16Lt&NLwۣHJwL NwwH Jww6J6Hhhhoihii iwbOidOw}wءHJ6bOTFVFwWFFFF-}=|.ubF FwgF Fw[F# FwOF6 FwChh6MPWtK wZ wFVFi Fwbb(b4b@bhb~}aw,tvvϕWvvjjjj wg jjvvvvj~g6iWDD3˸w*uw,uw6o6iWDDjSZcWDDFP!#Wjjvvhwh| j~gw؋6渇؋FjF=}wءڣhPFWDDFnWmWFVvvvvoPw6FPcWءiF=~ vWjWwx 2MD4MjhWh@R60M6.MRW Duhwh hhDohhDeMWŶthhDohhDjjjjwg jjhhDhwh j~gwNuLt#6Lt$6N6LhhDo L NwhhDo=~ E҉wt#w6LuhhDB3WhhDPowL Nwhwh PouwtPi1Wu=uwء-}=~.PfPP;WP=W}N3˸w6=PP;WPo#fMfe`ff`f`fPjjjjwg PvvoPhhjoVOXO"Wwڣ؃BODO6DO6BOlrg3)wx w6t 63˸w2u6.MQWhhg6Dw6~tXFPcW ~twtRhh6MwءRPjFjwg Pjjjjwg hwh 6N6Njjwg jjhh6Mhwh j~gjjPhwh j~gwtRPhwh hwh jCjjhwh hwh j/hhwءRPjXjwg jjhhhwh j~g؃BODO6DO6BOlrgVOXO"WwڣJ؃>u t2ءhw;twء;htءkF~~uWF=}w2u]w4uPjw6*VWF=tw66vw6jDcW /WF=t%˸w؃>$~3NZUwx ~u~tWvtOvvjw6jZcW w؁jjhwh/ hwh j~gw63hwh0 jw6jZcW Uw6FWDD}vvlWWF=vvlWU욉W}hwh1 jw6jBcW w63wڣ4wڣ2GW3w؃>^~ k~ ڢkjw6>JW ڢkwءF kwؠ4@kwؠ2 kwؠڢkwءR=t=t*=t= wtwظ&VwڣNw؃>~t.wءVڢkk2wڣv w؃>HuBkN֡H0ڢkw^t3w\t wءZwؠ2wڣZڢk k w|t wءz3wjt wڋh3 ºwvt wڋt3 ºwpt wڋn3  ڢkwpt wء& kw؃>^~ Hwڣwء_ ڢkwء ؈llhhkhhgokN؃>D|vD2- 2PFwءFwtwء;F~ w؋F~ }PFwڣwءwڣwBu+؃>D|vD2- 2wء@F=} wء@Fwڣ<w6Bw6<JWwڣ<wDw؃>D|=vD2- 2wڣD؃>D|vD4@wڢ wwDt5F!wؠ2PWDDvڈLFwءD;FҸ؃>D|vD2- 2 wڢ<r>v ؃>D| vD2#F= ~~?| ~_~ ~}F#wڢ؃>D| vD23wڣT=Yu wR4>T ~>T?|>T_~>T} wR wRR=t,=t4=twءNw;Vt>VYuKHwPWwtJwv t>v &u6wPwN&3wڣPtwءTwڣNw؃>~uwPwNNF؃>D|/v|BuFvD2-0F~|~~Fw؋FHw\؃>D |xvD Fw^tWw؀>Yuwؠ:FuIw\<~ ~~?| ~_~*~}$w\FwڣZ w\wr3wڣxwڣlw؃>~t~F ؃>D }vD 2- 2FwءhVtwjt3wڣlwءtVtwvt3wڣxwءnVtwpt3wڣrw؃>~t8wءzVtw|twPt3wڣ~F Fvv^2- t ءD;F}ܸwxt~F@;D}ovFFv^2- 2_vv^2 2‰FwtF;F|F ~Fwڣ= }Pwءwڣw6Bw6<JWwڣ<wpuءD;FvFv^2- 2F=~Fwڣ(w;&~ &wڣ(w؃>(}(>(~Dwrwء(w;"~&wء(@"w(wrw؃>(~Fw64w6(w6WFwء;F~w؋Fwڣw 3FNNgu:w6bOt4hh6Moww4tjjhwhH hwh2 j~gFFfF^hh6M;Wguhh6Mi1WFVFF~u;~u5vvhwhI hh6Mj~ghh6Mjjjjwg ~}~s؋FVNNDg~xwء؋6bObOdOt4hh6Mowu3hh6MI:WF=u~u~|bgg|hh6M;WF=tg~}<~s36M3hb6MFRUwww66hhogw؋ ۣwtwڣw`Wv- 2FvF@FFFjjvvhwhZ j~gvvT5Wt\6WFVvv>QWhhgWvvjjjjwg jjvvhwhp j~gjjvvhwh j~g3~u ~uvuFFvvFFvuv F vFuhhj6W~Rg3wڣwظwڣwtwڣw`W3 v- 2FFFFFFFvFvvtoF=to~=te~=unD=u=tG=tk=u=u =u=u =t .=uBqvvtowڣwڣ=tFvvtowڣj=tT~=t*i=tvvtowڣwڣvvtowڣwڣvvtowڣwڣa=tvvtowڣwڣ8=t+J=t|vvtowڣwڣvvtowڣwڣ=t2vvtowڣwڣ=:to~-=6tL~=-t#r=,tvvtowڣvvto+иw؉cvvtowڣ8Jvvtowڣ1=.t|vvtoF=u w&~u w&w؋F=8t#:=7t-vvtowڣvvtowڣ=9tvvtowڣ=ts~A=t&~=;tvvtowڣRvvtoF=}~~w؋FH(v=tvvtowڣwڣw؁>~w؃>^~^w؋F&wpw66w6$w6Wwڣ<=t4V=tvvtoF=~j~_}dw؋F"vvtoF=|@w؋F:=u-vvtoF=uF~|6~-3UFn;F ~ F ~-FFːFvWF@@V}wDt`D2FDw FAw*w 6hWDD}6,M6*MϕWEF˸w<uw؃>$e؋6h渇؋iF=Fkv؋l;ht+hڣDWkv؋llۣ.M0M60M6.MoڣDkv؋lFhwhϕWhwh,w2w ءhw$@VFءhFw؃>$~D؋6h渇tnt,؋6h渇DŽtnءh@@hȖWF=et~u*~uhwhϕWWhwheW@ng},hwhϕWhwh6,M6*Mo/~Eu~Quw2w F~Tuw6$6h6DWF~Yt~tv؋6D渇؋FjF=~ kvo؋6D渇tn6DϨWDD6DCWDDءD;ht6h渇DŽtnءh@@h~Ntlw 6DϨWDD~u{؋6D渇؋FjFF~|!~~kv؃o t 6D 6hWDDF=|FFE6,M6*MϕWwء@@;Duw؃>$Du?DHF=uw؃>St>Iu jWv渇؋FjF=~v渇tnkvoFYO~FEhwhϕWhwh6,M6*MoءD;htAw؃>$unWw<uWw؋FzȖWF=et~}qa~}WhwhϕWhwh5W@ng}~Euz~Qu~Tu7w*6hWDD|hwh ϕWhwhءD;hu؋6D渇؋iF=}hwh3ϕWhwhLw6$6h6DWF=u"6DW6DϨW~}6DϨW؃>`q}.6hWDD|hwhlϕWhwh~ءhFءD;Fusv渇؃i~Ov渇؋FjF=})kvot"v渇؃i8v渇؋FjF=|kvouvWDDFF@VF;Fu~t6hWDD|hwhϕWhwh6,M6*MoFEBwuF2ˊF$2F=et=mt=ot=sF؋vw؊ ʋF ‹vw؊ 4v$FF:F tB~ }9v2T2 ŠT2 ŠT2 ©u 3mv2T2#ŠT2#ŠT2#%=tvD$FvD$FvD$FvV2w: uNvDV2w: u6vDV2w: uvDV2w: ueTvV2w: tNvDV2w: t6vDV2w: tvDV2w: to~tWwۣ} wwtwء 1ɚoFV} ~wF^N\oFV 1ɚo)FVwءFVwءw;~wءFVFV;VB|;Fs;FV^NoF F=}FFFF;F~FFFwء;Vu;F t3FwءLF @@=^~3F=t3w-FVv渇؋FjF=|.kv؋F쉄nFnkvFoFkvowFwؠvv^FFFFF vv^Fvv^FFwءLF F~tyF_F_Fvv^ F vv^FF vv^Fvv^FFvPDW vv^FF"vv^~t3F Fvv^wءJ=tR=u=u(=u`FFvPgWF%?@ 2vv^FF%?@ 2FFvPDW vv^Fwؠvv^Fvv^vvvjsWwء=eu=mu =ou2=stjFHFFFFFV;VsLw;FsBv$N݋FFvPgWF%? 2vv^FFMFFvPWF%  2vv^FF%? 2vv^FF%?FHFFFFFV;Vsw;Fsv2w؊ vN̋FHFFFFFV;VrRw;FrKv NFHFFFFv2w؊ 4vNFV;Vrw;FsҸwDt6DhhLWw؋Fkvډnw6vvW}ˊFwڣw,wءJOLOwءROTOWvvFRPFPjwg wءv vv^F FF N uvvgWF%F%?FwtFFFv2#F3FVFvuFV%wtFFFv2#F33F3VFV% ҋw؋&(FVFV 3F3V^Nѹw3f3hFVFvtgFVwء@@VvFWDDF=}˸w؋F3Uhwh6hޑWv渇؋iFvCWDDvFWDDFv vv voPvjYcW ءh;Fu5~~ vW~~ vCWءh@@h3UhwhvޑWUvv6hޑW~|p~?jv渇؋FjF}vFWDD|Gv渇؋FjFkv؋oow;"~hwhjvjNcW 3Uw؃>,|`w twءwءk=}w;~ wڣw w6$6hvWFF~uv渇؋FjF~u ~|w<u~t~tw؃>,?|gtuwءLFwءJFwظLwڣJhhghhgoPjjYcW hwhvj#Ww؋FJw؋FLhwhjvjYcW w0hwhwءRPj%jwg 3hwh"6,M6*Mokv؋oow;"ĚWkv؃o u?w<tvWDDw0hwh4wءRPj%jwg `kvnkvnnWw0hwh=wءRPj%jwg kvnnvjSWkv؋ovv>QWhhg6Dw6jEcW Fwء(F(_WjWDDw؋F(w؃>} w )FUv v>QWhhg6Dw6FPcW3Uw6J6H>QWhhg6Dw6jRcWWF=} Fkv؋ llۣ*M,M6*M؋,M*MFV,M*Mۣ.M0MظDڣDwt wء wؠ2Fw6wؠ2PF2Pw6<kv؋ lHP6,M6*MmWFwءw;t wwءwڣ~|vWDD~} w,uwVtw<thwhFءhhwhGwءRPjTjwg hwhHjjrW؃>Nu jWTew؋FFNOPOFFOHOFw.FFvF6*M,M2- 2FtFF=~v6*M,M2Fv6*M,MF*M6,MPDWV 2;tvWDDhwhR{v6*M,MF&vNN6*M,M2- 2_vN6*M,M2 2ºw+LڣDF8~}vWDDhwhajwءLV+JJ؉DFv6*M,M2- 2亇ڣDFvv6DjrWD|>D?~vWDDhwhp$v6*M,M2FFwء;Ftw<t/~Nu)vWDDhwh6Dj#We-~It~SuFءDwLH8~NuJuFF=u=u=u=tyF2- 2HV2 2J ‰FF*M6,MPgW;Fuk~Eukv6*M,MFFv6*M,MF*M6,MPDWV2 2;uNv6*M,MvWDDhwhF*M6,MPDWV2 2;uvWDDhwhF2- 2V2 2 ‰FF*M6,MPgW;Fum~Eukv6*M,MFFv6*M,MF*M6,MPDWV2 2;uNv6*M,MvWDDhwhF2- 2 V2 2 ŠV2 2 ‰FF*M6,MPW;Fu~Etv6*M,MFFv6*M,MFFv6*M,MF*M6,MPDWV2 2;t*nv6*M,MvWDDhwh؋6D渇؋iF=t9w0hwh6DjrWvWDDkvl؋6D渇؋FiءDkvډlkvFl؋0M.Mkvۉllvv踇ءDRPFPjwg FSvWDDhwh/wuv u~}&"W<RFPhwhFPo '"W<RvFPhwhFPoFPj/W|v v jz/W} w FP!#Wjjvvhwhj~g؃>DO}>BOs>DO} >BOw6DO6BOhwh)hwh"j~g6\O6ZOhwhDhwh*j~g6PO6NOhwh_hwhEj~g6TO6ROhwhzhwh`j~gwءRPhwhhwh{j~gwءZO\O 1ɚ\oFVwء؋ʋFVoFV 1ɚoRPhwhhwhj~gw|wWwۣ|jv`>u>"tQwuDFVd1ɚ\owۋoFVvvhwhhwhj~gjjhwhhwhj~gU츇ءVOXOZO\Ojjhwhhwhj~g6XO6VOhwhhwhj~g6HO6FOhwhhwhj~g6LO6JOhwh,hwhj~gːUw4 w6 3 ~~} kF ;FF~FF FF FF^kFFFFFvFFDvFDvD vD vDvDvDvFFFF;F|Flkhhnhhqw64v)W F|fF#v渇DŽFjv渇DŽtnF~@|Fv渇DŽbqF~|縇؋Fkw6F`qhhlhh}w66v)W F|VFv渇DŽiF~@|Fv渇DŽqF~|縇؋F`qw6FU~|"~vգWDD|vvWDD}˸w؋F$3~|~?~ ˸ktk}Fv渇bqtvDŽbqkkvŴnkvFov渇؋FFjv渇DŽtnkvDŽnkvDŽo kvDŽokvDŽokvnnwۣw t$w66w;4~ wء6ڣ4FFwء$;F~k`qu `q|Fov渇quZvDŽqkvŴl`qwt$w66w;4~ wء6ڣ4FFwء$;F`qb~}~?~v渇؋FjF=wء$;F}v渇DŽFjkv渇DŽbqw t w6kvŴnkvDŽokvDŽnkvDŽo kvDŽokvDŽo˸~| wء$;Fkv؋lF=~~@}v渇DŽiv渇qt*vDŽq`qwt w6kvDŽlkvDŽlkvDŽl kvDŽlkvDŽlZv渇؋iF=~ vWDDF~|~? ~|~?~ 3ˋF;FtFF F=@}F;F}F;F}֋F+F F=~F;F}F;F@~?~n@F;F|F;F}~}F@F;F|F;F}F;F|tnU3U3vFP=W| W}Fwtbvw6.Fv6F &FF$vw6^^֎^؊&FFF;F|Ըwuvw6"Fwt?vw6"Fv6BFv68Fvw6#Fv6AFv6MFv6JFv6*Fv6!Fv6AF~t&~} ~wwtlFF~bvw6#Fv6F &FF$vw6^^^&FFF;F|Ըwuvw6!vvhwhF@@w6Po Fw@@6PoFvFw6F &F@@Fv61vvhwhF@@w6Po Fw@@6PoFvFw6F &F@@Fwuwt}vw6(w6hwhF@@w6Po Fw@@6PoFvFw6F &F@@FDuDuwuvw6+Fhhzo!vw6FDtvw6Pvw6MFF%vw6^؊z&FFvzűvw666oFw؃>_}wءL\+JJw+LVF;F~ hwhjw66vw6jAcW 3FFFFvFjj6>6<hwh&j~g˸w<.>w34FΠFЇvNFFmFF6FKFFTFF^FF$ί֯ޯ毿vFFuLwuv |^|e|\v]v t^t\hh6M;WtFv1vv2- 2FFF-!|= .FFsv ||>vvڈFFF;F}~ |ۋvƄF;F} F+FFwuv DDv FD؀>At>Btw6.w twءwڣw v ttjv v hh6M@W w6vΊFFFnvv6DFFF;F}~(|ދv6DF;F} F+FFwu!FPŒov D(T*vvڈ(FFF;F}~ |ۋF;F} F+FFvƄ(wuv D4(D6v FD2ؠ(w:tFvΊFFsvvڈ<FFF;F}~d|ۋvƄ<F;F} F+FFwu v D:<D<v FD8؀><Mu><Ptkvvڈ2FFF;F}~ |ۋvƄ2F;F} F+FFwuv DL2DNv FDJvvڈFFF;F}~|ڋvƄF;F} F+FFwu.v DXDZv FDVvv6DFFF;F}~(|ދv6DF;F} F+FFFPŒov D\T^UvD\D^vDvD/DwvDvD 0DwvD vD41D6wvD2vD:2DvDF;DHwvDDvDR<DTwvDPvDh=DjwvDf3U3v v vv߷WVOXOwءڣwءۣwءڣwءڣwءڣwءڣw؃>u3ڣhhv v vv̺W Fujjvvhwh>j~gwtRPhwhPhwhBjjjhwh]hwhQj~g؃>N|#>Nvhwh^6N6Njjwg F˸w؋6ssjjjj wg jjvvhwh_j~gUv6<jjjjwgwF˸w6uɚmWhwhjjjw twءwڣw w2j,WDDF|jjhh6Mhwhj~ghwhjjjM6Mtwthh6M23Wjjhwhhwhj~ghwhjjjjwgF˃~t:w8tmWjjhwhhwhj~ghwhjjj봚mWhwhjjj롐s]W}`Wt"w,us]W}w<wwLNws]W}w<w s]W}kw w s]W}IwwCjIZcWDDws]W}wwKǚs]W}wwGjoDDs]W}w<wwLNww 8wuu s]W}ohwhϕW)3˸w؃> uQw\uDhwhϕWs]W}w<wwL NwWw<60M6.Ml_WwءHwڣJ=uJwڣLw_W"WY60M6.M(pWhwt+w6J6HwؠPXWww؀> uW"Whjhwt+w6J6HwؠPXWww؀> uWh6hϨWw<wؠwڣ=W560M6.M(pWmWRPWQ_W wXuDhwh ϕWs]W}:w<wwLNwr2MD4MjhWh@R60M6.MRW wLNwwHJwhhD+igwڣw<`Wts]W}w<wwLNw2MD4MjhWh@R60M6.MRW j@RWDDj@RWDDDt]DwڢDw<ww؃><}"w6Bw6@JWwڣ<w \hwhϕWs]W}w<wwL7NwwZuDhwh8ϕWs]W}Iw<wwLMNw2MD4MjhWh@R60M6.MRW j@RWDDw<hwhNhhDzWt?ww؃><| w6Bw6@JWwڣ< hwhOϕWs]W}lw<wwLgNwwVt hwhhϕWs]W}w<wwLvNwPhwhwϕWs]W}w<wwLNw hwhϕWs]W}w<wwLNwwPuDhwhϕWs]W}?w<wwLNwwhhD zWuhwhϕWs]W}w<wwLNw!wTuDhwhϕWs]W}w<wwLNwwPuwFPhhD4WvvhhDotLhwhϕWs]W}w<wwLNww w؃> tDtwءdf wءhjFVhhDvvzWthwhϕWs]W}zw<wwL&NwwRuDhwh'ϕWs]W})w<wwL>NwawPuwFPhhD4WvvhhDotLhwh?ϕWs]W}w<wwLMNww w؃> thhDw6^6\zWthwhNϕWs]W}0w<wwL`NwhwVuDhwhaϕWs]W}w<wwLqNwőWhwhrjjjjwg AwfuDhwhsϕWs]W}pw<wwLNwőW/Whwhjjjjwg |gb*WyWtMhwhϕWs]W}w<wwLNw+w^uDhwhϕWs]W}w<wwLNwhhD{WtőWhwhϕWs]W}Ew<wwLNw}wbuDhwhϕWs]W}w<wwLNw,wPuwFPhhD4WvvhhDotLhwhϕWs]W}xw<wwLNww w؃> thhDw6n6lzWtUhwhϕWs]W}w<wwLNw3w`uDhwhϕWs]W}w<wwLNwؠD2亇ڣt> u3uQwPuDhwhϕWs]W}.w<wwL!Nwfthwh"w6r6phhDw6v6tzWڣthwh#ϕWs]W}w<wwL5NwwduDhwh6ϕWs]W}Mw<wwLJNwhhDw6z6xzWuDhwhKϕWs]W}w<wwL`Nw"wZwVuDhwhaϕWs]W}w<wwLoNw)wء(ڣw(_WjWDD"Wwڣءwڣ(hwhpϕWs]W} w<wwLNw(jhWhiR60M6.MRW 0Mu.Mt6.MthwhA&Ww,us s]W}a w<wwLNwwhh6McWuThwhϕWw,u s]W} w<wwLNw(hh6M>QWhhgWhhLD|Ww6(WDD}\hwhϕWw,up s]W}^ w<wwLNww w wőWhhLD|Ww6(WDD}\hwhϕWw,u s]W} w<wwLNww wVw6thwhWhwhNhhLD60M6.MWu_6D6DW6D6DWRPjjjjwg w6thwhWwthhLDԻWhhLDhh6MWڣujhWhzR60M6.MRW }\hwhϕWw,ug s]W}U w<wwLNww őWw hwhϕWw,u s]W} w<wwLNwőW"Wwڣ iWw,u s]W} w<wwLNww2u w6thwhw4thwhW jhWhzR60M6.MRW } hwhϕWw8u  őW~ 3PWDDw,us]W}w<wwL(NwwthhLDԻWhhLDhh6MWڣthhLDhh6MfW|hwh)ϕWw,us]W}w<wwL;Nw(uhhDjjjjwg jjhhDhwhj~gwltwءw PWDD}ThwhϕWw,uls]W}Zw<wwLNwww6(WDD}\hwhϕWw,us]W}w<wwLNww kW|_WjWDDhwh[VOXO60M6.MUW}Gw6_WhwhZmW_WjWDDhwh.mWw w6(WDD}\hwhϕWw,us]W}w<wwLNww kW}Zw=60M6.MWkW|_WjWDDw2uw4u hwhhwhw2uw4u3ڣ)w2FwW~vw61iWDDtwhwhϕWw,us]W}w<wwLNw"WwڣvmWw w,u]s]W}Kw<wwLNw㸇60M6.M[|g)wء(ڣw(_WjWDD"Wwڣءwڣ()u(wtw,uhwhggwءw w,tns]W|_w<wwL Nwhwh!ϕWwءw w,ts]W}jow<wwL8Nw%!ƾAɿ«-qŵ\ɄRJ̧iUЙ_ӼӕA׋نڴW- F=|~_~Fwk6`vw؊F=tƋF-|=3.Yw*t4w'|swuhwh9Dxtw,w(twuw*u"w66A&WhwhA&W@hwh%WhhNA&WhwhA&Ww8tjjlrg w,w*tw(twt)tw؀>DvuXhwhA&WhwhA&Whwh]hwhiA&WhwhA&Ww؀>Drtw>Dsu,hwhA&WhwhPA&WhwhQA&W>Dgt>Drt>DctjoDD"WWw,t6w(u)wuhwhA&WhwhA&Ww*u/Whwhjjjjwg w,RwRPJUhwh{2%W6pO6nO%Whwh $%W~}F.sF-|=_~k"_F}hhhwhV"o`hwh))w66hwh!"ohwh`$hwh)EW*hwhl)hwhhwh w6%6%1WhwhhwhIhwh%hwhۋָw6%6%1Ww؃>uw6؋((RPw65@2Phwh"o hwhŌkhwhbhwh)-hwhPhwh+hwh >hwhV5hwh,hwh$*hwhhwhyhwh'hwhʑhwhhwhxhwh()w6%6%hwhǒhwh;hwhk"_F|UFhwh?hwh(fhwh8*]hwhfhwh\whwhnhwh?ehwh\hwh%'hwh&hwhAw6~&6|&1hwhP)hwhΗhwhhwhL*hwh`*hwhĘhwh$hwhahwh`&h_h׊hwhߙhwhЙ6N>hh=_FvWfhwhw6z&6x&w6&6&hwhxh_h׊hwhhwh6=hh4<_Fv^WFhwht* hwh,hwhj#hwhhwhhwhhwh*hwhKhwh<)hwhhwh*hwh#hwh*hwh )%DL\3~} FF˚k"_F|F-}=C~.hwh+EWChwh+hwh+hwh&hwh+hwhhwh+hwh&hwhK1Whwhhwh|hwhhwh'hwh*hwhhwh4,xhwhT,ohwhhwhmhwh'Vhwh'Mhwh\(Dhwh'hwh&3w66hwhĚ"owu7w66hwhĚ"ohwh*Ś"ohwhŚڣo3hwh,hwh,hwhhwh,hwhhwh&hwhhwhUhwhhwh-uhwhd-lhwh,chwhx(ZhwhH+Qhwhhwh,?hwh-6hhhwh_ɚ"oK ?xGOxXaxx{xxxxxx B'xx906Kfox-xrxxTxxxxx]xxx%xxja~u hwh(~}F1.k"_F|F-|=~ޚk"_F}zFhwh~hwhhwhy˚1W;hwh>hwhhwhhwhhwhhwhLhwh-EWhwhhwhhwhhhhwhК"oonv~]]]]]EwH3JwL3Nw.3ڣ"؃>jO6fO4<-u6fOt<-u6fOtti1W|rvljO؃fOW6fO4DFFPUWDD}9+؃fO6fO4<=u3ˎ6fO4<-tVWjj*~gjOw*u'؃>"ct w.thh3ggw6Lt(؃>"st>"rt>"vthh3gg؃>"vu5wt(w*ujoDDthh3gg؃>"st>"vt>"rt>"xu;w*t wwtww(w(t wء"6fOT@FV؃fOjO>jO|6fO4<-uhh4gg6fOTwۣ@Bw"thh24gg"xl"thhF4gghh\4hh[4hhZ4jFhg2亇ڣ"("thh]4gg"v"thhq4ggwʸ"thh4ggvDthh4ggF3wڣ؋hOfOۣbOdO-"thh,5ggvDthh@5gg؃fOjOjOt6fO4<-uhhc5gg6fOTwۣHJ"rw.w0VWwtjj*~gvDthh{5gg؃fOjO>jO|6fO4<-uhh5gg6fOTwۣLN<P.vDthh5gg؃fOjO>jO|hh5wvDthh5gg؃fOjO>jO|6fO4<-uhh6gg6fOt4hhNohh;6hhNot3wڣ*~ltKjw6hwh*hhN,W }hhD6ggWwvDthhV6gg؃fOjO>jO|6fO4<-uhhp6gg6fOt4ŒoFV 1ɚoFv WDD=~w؋FVqhh}6BvDthh6gg؃fOjO>jO|6fO4<-uhh6ggFP6 [6fOt4hh(Z(3_F=}hh6ggw؋FvDthh6gg؃fOjO>jO|6fO4<-uhh7gg6fOt4toF= ~2wء;F|%w؋Fwڣ~^5^,hh7ggvDthh07gg؃fOjO>jO|6fO4<-uhhJ7gg6fOt4toF= }"w؋F&~wphhe7]wuw&w\w(NvDthh7gg؃fOjO>jO|6fO4<-uhh7gg6fO4F=et=mt=nt=ot=suFwڣwhh7wwwNwsq-\jx AN;FvFFu3ˊF-C|=7 .hh7w"sw머؃fO6fO4<-t(6fOt4i1W|0=v)whh46fOt4ouFjOjO؃.fOw؃>}~uhh4gg~~hh4gg~uw~hh4ggwtjoDDuhh 5ggUUUUUUUUU츇ءȋ;Vu;Fu؋FVvvWvD3ː6ȋD,Frt6D,'"o6ȋFD,j6ȋ %P^g6Dt!hoh.|j6ro j6rDHPffoWr`ohhzoUjRfoDDjb_DD6ȁ$6rDHPj6rDHPjLioWhoh.|j6ro hoh.|j6rthtfoU{o{ogoFRFFFv^w_TFVvDFFFFFFFF@v< t4FFFF~uF3ҋ^3+ѻ1ɚoFv FFV;Vwr;Fr~uv^w_;Fv^w_Ⱥڎp6r ~hjoFVvvvvFoFPhTvD PoFt v؋m6ȉD*˸FPjv v o |`oFːU6rrlPhT6rjo6rur>r~6r lːvvv v P_ PvvWːUv t"v F PvvXg=u۸3Uvv#o"oUːwڣUFVt3UhvvhhowUF HPhhvvov Nv^ wuw6 6 _FF~u~t3FFFFFPFPvv^ }+FFvvhwh; "ohhzoFFFUh66hh捚o 0_Uw3wڣ ≺ڣڣމU츇 6>w r>rḇB3ڢڢ>ڢڢ捺ڢꑸw؋F 0_w؃> | ءމwk6 ډ򖸇ءwk6 ډءwk6 ډءwk6 ډ؋wk6 ۉėƗ؋wk6 ۉȗʗ؋wk6 ۉ̗Ηhh≚o@PoDDFVu~thhvvowk6 ؋FhFj~u ~ujhh捚o@PoDDFVu~thhvvowk6 ؋FlFn~u ~uhho@PoDDFVu~thhvvowk6 ؋FpFr~u ~uhhꑚo@PoDDFVu~thhvvowk6 ؋FtFv~u ~u2hho@PoDDFVu~thhvvowk6 ؋FxFz~u ~uhh>o@PoDDFVu~thh>vvowk6 ؋F|F~~u~tehhBo@PoDDFVu~thhBvvowk6 ؋FF~u ~u˸w6 _DD3Uw }k6 ؋򖺇ڣމwk6 ؋ڣwk6 ؋ڣwk6 ؋ڣwk6 ؋Ɨėۣwk6 ؋ʗȗۣwk6 ؋Η̗ۣwk6 juhtbhwk6 jhhh≚o wk6 jh:owk6 DŽhDŽjwk6 nultbhwk6 nlhh捚o wk6 nl:owk6 DŽlDŽnwk6 ruptajdwk6 rphho wk6 rp:owk6 DŽpDŽrwk6 vuttbhwk6 vthhꑚo wk6 vt:owk6 DŽtDŽvwk6 zuxtbhwk6 zxhho wk6 zx:owk6 DŽxDŽzwk6 ~u|tbhwk6 ~|hh>o wk6 ~|:owk6 DŽ|DŽ~wk6 utbhwk6 hhBo wk6 :owk6 DŽDŽw Uv< uv Fvu~ tvhwh? "onjjFPv v vv/_F=|FFFvvy2_tFP/0_F=~vFvt}cF˃~u~t@FFFFhhFPvv^ FFvvy2_uvvtov3vu FZ Fwvf DwjjFPv v vv/_F}~u~t@FFhhFPvv^ F}FFvveMWFVvtvv-_FFvvPWuChwh vvotDvv:2W}2vvhwh "ovvhwhg "ovFFDF"F3wڣwڣ v DwءމF=t2v v -_)6zzz2 ~uvF F Dv4u˃~u~tDFFhhFPvt4^ F}ovDvt4o@PoDDFVu~uhwh "ovt4vvovt4I:WFV| ~v3v~u~uvt4hwh ~|~svt4hwh i~|~~vvt4;Wvt4i1WFVvvI:Wvv:o~u~t+~u~t0~;|~s3vt4hwh/!vt4hwh vt4hwh!Fމuvt4oڣv8"DwءމF=t$_F؋vTwءF-}= ~.uvF F D~u~tZFFhhFPvt4^ F}ThhowڣvDvTFVvvoHFvv^N~~vv^< t݋F˸uBv v hwh9""oމ3wڣ v v -_wڣz}hhzjWo6zzz2vuhwh=""ovvhwhJ""ohhhhFhwhN""o hhzo4vhwhT""og$_FUvvhwh"vvvv v vv'_vvoFw3Fwڣ ءމF=tvv-_{؋Fwuvv-_~u~tAFFhhFPhh^ }Shh-_FPv hhvv(3_F=t=t-~uFNhhhwh"wuPvuvvhwh""ovv -_vv-_މ3wڣ ~u~tAFFhhFPhh^ }]hh-_FPv hhvv(3_F=u=z|6zzz2z}hhzjWo~uhhhwh""ojvv^t_uoF@F]~u~tAFFhhFPhh^ }hhh-_FPv hhvv(3_F=uhwh""oމXv uhwh""ovv hwh""o~jvv^t_ucF H;F~8w6vFv^t4vv^t40o t"vv^t4hwh#"o#_Fx xx7$_FwءFF-|= .vhwhL#"oމ~t؃>މu޸މhhhwh""oމFF;F}vv^:uߚ$_믋vv^Dvv^;Du%jvv^t_uFF FF;F |wءvv^TFVvvhwh""ovv -_މ3wڣ Fw6hhꑋvv^t40o u6jvv^t_uvv^t4#_FF;F |z$_u7~uvPhwh#"o~~vvhwh,#"ohhhhFhwhG#"o hhzoFFFFFvtv:uvtv3w3Fwڣ ؃>މt@hwhv#-_Fhhhwh#"o˃~~hhhwhw#3~u0z}hhzjWoj6zzz2W~tQ~hwh#"ohhhhFhwh#"o hhzo"d#"" #""#$_FwءFF-|=.R#U츇3ڣF!vڋ6ڈFFwء ;F~vuvt؋6Ƅ+wء w> ;8؋6Ƅz$_˸؋6Ƅ Fwء ;FU츇؋6Ƅhhhwh#"o#_U츇u&ءމڣމ3FFFFFFt؋ۣ66~t Fv؋ۣ66-_w ظz}hhzF2PWoF6zzz2万666-_ظ]~uT~u,666-_ظ%z}C6zzz2~t ~t؁>r:w>v0._6< u w 6Jz}hhzjWo6zzz20_36ء;vs;r ~u~uj؁>vgr >vZz}hhzjWo6zzz20_36u~t6hhFhwh#"oFFvFFuhhzo=z|F혋7yWt4F1hhzF혋7yWtF^2PWo돸^ڋ6zzz2t~ }9~u3~u z|hhzjWo~uj._6ءrw=wҚ0_36wء!F~tM~\u ~uF~ uF ~ u~tF F~;t~#u$w uF؋FV~t~ tFڋ6~t4z}hhzF2PWoF6zzz2w u D؋ۣ66-_މ3wڣ 3˃~ t ~ t$~u?FP._/FF~ ~+~?t%~t~t؋6\F~tvFP._~u w ~un~ thFڋ6Pz}hhzjWo6zzz2hhwh#"oމ؁>wr>sFF6Ftw tFj._FF~tow؃>t._6>r,w>r"6< t._6؁>rw>r 6< u̎w ظ@؋6< t66-_ءڣމ~t~u~?tء;r#w;v6| t6| t6ء;sbw ;wW6|-tC~uZ)Fvڋ6FFvt؁>w rˁ>rø؋6 6؋ۣFwFFFV;Vu/;Fu*F>FvvvvoFFFFvFv< tvvFFwv< tv< tvtv< uvwءUv7yu3Fvuݸz}hhzұoFˋ6zzz2Uz}hhzF2PWoˋ6zzzF2Uw thwh$"oUw u~uz}hhzjWo6zzz2z}hhzj Wo6zzz 2z}hhzjWo6zzz2z}ChhzF7yWtF^2PWo6zzzF2ˊF7yWtF^ڋ6zzz̸z}hhzFF9vTFVu ~u7vFF~\t"vF={uFvFFFF=8tq?=4tj!=2tc=1t\~=0tR=3tJ=6tB=5t;=7t3=XtF=Dt!=9t=Ot =ot!=dtFF F9FF7 =xuhFF~  F3F~ucvFP22_DDF}FHvFP22_DDF}F-vFDˋF%V ‰FF~tv<}u ~~FvFFDF븋Fnv؃0^FFvt#v<0|v:F~} Fn=|~t~~vFPU~0|~9F-0F-7ˀ~A|~F~~a|~f F-WݸFFvFFtHF= t= t=+t=-u~u&F̃~uĀ~0|~9 FF3ˋFF-v7ytvPoDDvFFvuˋFv v 2_Ft~} Fv v vv^t4ot[vv v vv^t40o u3Ft4vv v vFv^t40o t vFvL~t_FFH;F~]vv v vNv^t40o uFHvvNv^D h_h׊hwhhwhָw6hwhTӚ_F} FF˚k"_F| )t&~tֺwֺwRPhwh֚"o!~twuhwh֚"o+Fڣ)h_h׊FPj hwhhwh֚| _F|#~|~|hhwh֚"oFh_h׊FPhwh hwh֚V_F|Ջv6Dut9؋v6t4:ov6Dvvo=t =u0v6^&v6Fv6F&vvo@PoDDv6Tv6Dut#vvv6t4oFF-}X=>~P.9hwhך"ohwh7gh_h׊FPj hwhhwhpؚ| _F~}FhvvhwhX;g vj\gHh_h׊hwhohwhnjhwhҚ_F}$k"_F}[~tAhwh׃~t{׺w}׺wRPhwhwGhwhڸ66hwh+w؋F8Jagjv'cg 4_h_h׊hwhhwhjhwhҚ_F}k"_F}jw؋F)i~ghwh(hwhך"oth_h׊hwhhwhjhwhК_F}Lk"_F}w؋FH~u~uBvhwhhho hwhhhhwhjShgwڢDD2h_h׊hwhhwh׸w6 hwhК_F}V~u,h_h׊FPj hwhhwhך| _F=} k"_F}[v'WDDwڣw؋FK8 : : :6 : : : : :-7 :767 :666 : : : : : : : : :6 : : : :"7 : : : : : : :7 :7 :8 : : ::87 : : : : : : : : : : :18F=uS=u='t+=4u6=6u=7tء)Vhh_h׊FPj hwhhwhך| _F=}Kk"_F}<~} hwhh'jvء)hPeh_h׊hwhhwh׸w6hwhӚ_F}h_h׊FPj hwh*hwhؚ| _F}m~t~u#k"_F}R~uwOhwh,~t=w/_h_h׊hwhHhwhGظw6&hwhњ_F} k"_F}F=t=t#=twظ?whwhI^F=t0=tt=0t=@thwh;gg=gh_h׊hwhhwhjhwhњ_F}7 k"_F}nw؋F+jhwhhho h_h׊FPj hhhwhؚ| _Fvvhwh;gڣ)ء)F=u= u= u=u =+u=BF=uP=u=u=#u=(u=<u=At5h_h׊hwhhwhjhwhӚ_F}$ F=t]hh7vBgGh_h׊hwhhwhظw6hwhњ_F} k"_F} ؋FN=twظ h_h׊hwhhwhظw6FhwhҚ_F}c ~uFh_h׊FPj hwhhwhؚ| _F}w ~| ~~~t hwh k"_F}M ~W~3wڣw؋F h_h׊hwh#hwh"jhwhҚ_F} F=t=t ء)hPhhV8h_h׊hwh2hwh$ٸ6 [hh(Z_F} k"_F}w؋F:[A h_h׊hwh8hwh7ٸw6hwhjҚ_F} k"_F}4 w؋FtwP wP jjFPhwhVhwh=ٚV_F} v<{u/vvoFNv^<}uvNv^Fvv_h_h׊FPj hwh{hwh`ٚ| _F~}Fhvvhwh"X;g F}M wء"w;& hwh~w6"hwhhho ~u؋F)hwhhhhwhh_h׊hwhhwhjhwhӚ_F}yF=t=t hwh8jhwh66o h_h׊FPj 66hwhٚ| _F}~}hwhٚ"o;k"_F}vhwhڸ66o ~tw؋F: hwh;g h_h׊hwhhwhjhwhҚ_F}mF=t =t$=t2=t 7V hh7ء)Bh7, F=!uHgPF=/tt~=u~=tm~:=th_h׊hwhhwhjhwhК_F}?hoDDFVu~uhwhRgFh_h׊hwhhwhjhwhК_F}SF=tu=ty=t]h_h׊FPj hwh&hwhߚ| _F}Yk"_F}J~ ~~?| ~_~<~}6~u"F2wڣhwh^RhwhFwڢhwh'=twt hwh5R螇hhNhwhd66枚o h_h׊hwhhhꞸw6hwh(њ_F}~tohwhښ"o^k"_F} w*u hwhF 1ɚ\oFVu~Fu FKFv WDD}vvhwhw؋FV)u)tw؃>u>"uhhNhwho66hhNhwhښ"o M=$t~Q= tIvvJg^h_h׊FPj hwhhwhۚ| _FjvvFPX;g F=}~}F~tFvhwh66o hwhܸ66hwhw؋F&=~3wڣpw؃>&aw66w6&w6WFwء;Fu+F )uw6&w6hwhܚ"o=%th_h׊hwhhwh۸w68hwh(Ӛ_F}~th_h׊hwhhwhjhwhҚ_F}F~uk"_F}Yw`\h_h׊FPj hwh7hwhۚ| _F} ~~~thwh9ۚ"oh_h׊FPj hwhhwhjۚ| _F}~|3k"_F}w`w؋Fbw؋Fdhwh댃~th_h׊hwhhwh۸w6Rhwh:Ӛ_F}^k"_F}~u3wڣ|~u3wڣ~3=;tV~=1t/h_h׊hwh0hwh#jhwhHҚ_F}*k"_F}؋F)h_h׊hwhhwhjhwhZҚ_F}k"_F}w؋F=Dth_h׊hwhYhwh@jhwhК_F|MF=th_h׊FPj hwhhwh`ܚ| _Fh?vvFPX;g F=}F?~}F؋FJk"_F}hhhwhLߚ"o)3h_h׊FPj hwh݃~uܺw[ݺwRP| _F|~u~t~u~tvv:ojhwhhhꑚg t4jhwhhhꑚg tjhwhhhꑚg uk"_F|3FCFhwhQ~u~tvv:oF+FF~~~|~~~|F;F|~~vhwh{ޚ"oHF%F~uY~t؃>NuG~t~u; )thwhޚ"o~u~tvv:oLvv^FFvw؋v vv^F~|ۋF=u=uvw؋Fv F~ |Fvw؋Fv F~|w؋Ft ؃>Nut~un )uhwhݚ"ohwhޚ"ovv^vwډv F~|ۃ~u~tvv:oPظ$wؠ2Phwhbߚ"oFvwv FPvv vhwhߚ"o ~uw6t hwhߚ"ohwhߚ"ovƐwv FPvƀv FPhwhߚ"o ~uw6t hwhߚ"ohwhߚ"oF~}/hwhߚ"oءjOF؋hOfOFVhwhhh6oP~yu>FN~}hwh ggvt4hh6o7<~dujhwhW_$~zu w~Su wN~#Fv4<-uv4DFNu3NFvvvW}>hwhQ*w66NvvW}hwhg"o3Fh_hNjoFVFFFPWDD2PWDD} hwh7t 67"W7uwtwء#FP%WF/WFFF;F|.jm WDDF=wtfwء#FP%WDDF붃~ uw~u(7t7PWDDvڈF~tj WDDv:tj WDDvڈF7uj i~tyFF7tKwt>Ft7jWDDvڈFFPWDDvڈFjFPWDDvڈF~x}~ t ~tFFvƄvvvW|FFwt\7tOwu w؃>u6FFFFhwhv$FvuvvA&W7t 67"WF te~ u_FF ;Fujm WDDF}7tԸwuǸwtfFP%W릸7t wtlnWhwh}"oFzW|؋6rWrWtW2r.WF=tqwء$!FwuN/W~1jm WDDF|!wtfFP%Wƃ~~ubIt0FFvFPWDD2PWvuvvjoj,WDDFF=t&=t:=th_h׊FPhwhhwh0h_h׊FPhwhhwhh_h׊FPhwhhwh䚆 _F=|YvvhhꞚoFFh_h׊hwhOhwhCjhwh _F|FFk"_F}3FvvvV_wڣ vhwh$"oF=t=t%=tvvvTU_wڣvvv%W_wڣ j,WDDvu3˃~ tOhhjjjjvvjX+WF=~vvhho Fcj,WDDvu3˃~ tOhhjjjjvvjX+WF=~vvhḥojjw66hwhSj~gjjhwhdw66j~gFP!#Wjjhwhevvj~g ̣Fj,WDDvu3˃~ tOhhjjjjvvjX+WF=~vvhho FcU3 hwhfڣowthhNhwhahhNhwh"oWFV|shwhw؃>u>"uhwh"ovvhwh"ohwh"ow*thwhhwh"owuXFء [;Fv؋,Zw;u$v*Z(Zhwh"oF뭸w؃>uhwh"ow؃>uhwh"ow؃>u2؃>pluhwh>plthwh"ow؃>uhwh "o؃>pluhwh"ow*tNwu3F=uw؃>"uzFvhwh*"ohwhihwhA"owءPfgDDRPhwhE"ohwhO"owthwhZhwha"ohwhh"o؃>N uhwhohwh >Nuhwht"oGNt>Nt҃>Nuhwhhwh}Ѓ>Nuhwh6Nhwh"ohwh"owtw6hwh"ohwh"ow*uwtwu FFw0>u FFw>u FFw FFwvvhwh"ow؃>u/wt6hwh"ohwh"owBt WthhWhwh"owء5@2P6hwh"oUhwh$"oUw} w*t]_~u~tvuHhwh\"ohhzF2PWo%6zzzF2FPhwhd"ovFFt~~؀~}Ҹz}hwhjUUuUt UUwRPhwhl"oUtwwRPUtwwRPhwh"o UtwwRPhwh"oUtwwRPhwh"oUtwwRPhwh"oUt/w2wRPhwh"ohwh6"ow6gDDRPr\_hwhJ"ow6gDDRPr\_hwh_"o6U6Ur\_hwhn"oU~6Uhwh~"ohwh"owutRPhwh"o3˸whwh"ohwh"owjthwhhwh"ohwh"owtwwRPhwh"ohwh"owء=t=uFFwFFw FFwvvhwh"ohwh""owthhhwh7"ow6|hwh<"ohwhS"oFv؋Rw;tFء;Fָء;Fuewv؋NPRPhwh_"ohwhm"ow thhhwh"ow6~hwh"ohwh"oء(=t(=t1=u=u8hwhhwh"hḥChwhhwh hwhhwh"ohwh"ow uhwh"ohwh"ow؃>$uhwhhwh뢸Phwh"ohwh "ow8t/hwh""ohh6hwh/"ohwh?"ohwh'UhwhA"owBt#w6>w6@w6<hwhi!w6>w6@w6<hwh"o w6:hwh"ow6Fw6Dhwh"ow؃>Huhwh"o6Hhwh"owؠ2Pwؠ2Phwh"ow6hwh*"owؠ2Pwؠ2PhwhD"ow6"hwh["owؠ2Pwؠ2Phwhu"owPtw6Nhwh"ow6hwh"ow6hwh"ow\tw6Zhwh"ow6w6 hwh"ow64w6&hwh"ow66w64hwh"ohwh6"ow؃>~u hwhQ"o˸w|t\wdwRPhwhY"ow|t1hwh{w~tswuwRPhwhm"o hwhUw66w66hwh"o W_ b___ hwh"o6DO6BOhwh"o6XO6VOhwh"o6\O6ZOhwh"o6PO6NOhwh"o6TO6ROhwh"ow6,hwh1"ow6.hwhO"ow62hwhm"ow6*hwh"ow60hwh"oDO} BOwwءPfgDDRPhwh"owthwh"ohwh"owPtw6Nhwh"ohwh$"ow~tFwJwRPhwh("ow6&w64hwhM"ow6w6hwhq"ohwh"ow\t'6`O6^OwءZPhwh"o hwh"ow؃>Juhwh"o6Jhwh"ow6hwh"ow|wWwۣ|?v5>u>"uhwh;"o66hwhb"ow؋ʸءZO\OoFVvvhwh"ow؃>}>cvw>u>"thwu[wءd1ɚoFVFVd1ɚ\o^No 1ɚoFvhwh"ok%W_FwءP*$WFFFFw*t86Nw66WF=}hwh"o3˃~ u~u FF wv voF=}3F~FFF؋6)渇VtF@@PoDDFVu~uhwh"oFFFF7vvv7ytvPoDDvFFvuvFFFF ؋77wۣ<>"WFHw*t1jm WDDFc&WFt%FNuj&Wj&WDDF~F2w#"F؊FF"WFFu~uzFH؋6777FH؁>7rw>7Cr7B767ƄP8tF2P%Ww t2)u~ tF2Pj 0W} w ~t؋6)渇Vu#F27ytF2PoDDFvv^ :FtOFFFN~?vv^ :FuF+FFF+FPF+FFv Pv v0o uFvv^ uF,"WF;FR8F+F;R8؋6)渇Vu~u~tvv:oFFFv voFFF؋6)渇VtF@@PoDDFVu~uhwh"oFFFF7vvv7ytvPoDDvFFvuvFFFF ؋77FVvFF~rw~Cr FBF؋6)渇Vu#F27ytF2PoDDFvv^ :FtOFFFN~?vv^ :FuF+FFF+FPF+FFv Pv v0o uFvv^ uFء77;Vt;Ft ؋6)渇Vu~u~tvv:oFv Tۣ~u~tuu63vvoFtNvv^ڋ6vv^hhvv o_<~u~u F FwFPw6 vvhwhR(3_F=} w˃~t/~tv TF҉Vԅutvu& wv Dutv M wvҀ<\uFvҊF<%tFvҊFFFwFu~0|4~9.n0T8|3k6T8 F͘؋,F͘7ytn F͘؋쯋ꯉF҉Vԃt\~tSw~&tFPFPvvҚ_ } wvvʚ_~Onav渇؋;F|8v؋FĉVƃu~tvvĎ^ƋT^~t~twCFg 6T@vvָ66Ȧ_ F=~kv 6DTwF҉VF vv֚_F҉VFE F֋V؉FΉVRPoFFFw~u ? F0Fԇv~vv֚I:WFvhwhd~hwh"o~u ~u~u ~uvvoF=|~\tRvDF=Vu*~=Fu~=%t~=$u>FvFFFF~0|3~9-T8|6k6T8 F-0؋,F7ytn F؋쯋ꯉFVu ~u"FPFPvv=&tFPFPvv_ }F5=Mt*c=mt#=fuWFŒ҉FމVFF@=vu;F@@FFFv<(tvvFdFFŒ҉FމVF>FP/0_F=}1FvFFn~|E+wvFvFFN|˸6T@FP66Ȧ_ F=~kv 6DTwFVu ~uvFvFu NFFN}sFP^_FFދFF=}v<(uFvvވuv~}\>FFދFF=}v<)uFvvވuv~}}vFtvwv FFDvF3v<[uFv<]uNt Fvuv<]uFvv_~n`v渇؋;F}lv؋FVu ~uEvv^Du u)FPFPvv^t4׊_ Fvtv<(uv<)uFF@@PoDDF։V؉FډV܃~u ~uzFvF6DF6DFFFFFvvڈt\vڀ<(uFvڀ<)uNuvFF4vڀ<,u~uvF@v6DF6DF~u~u ~u ~uvv֚:ovFPFPo_ FVu~t'vFvFt FN}NF~u ~uvv֚:oFFFvtv<)uv<)uFFFFFFPo@PoDDFVu~tJFŒ҉FVvvvvoFFPFPvv׊_ vv:o~$u FP oW~mu~Mt;Uh oDDۣu u˸6D6DD6D3hoDDۣuuhhgghoDDۣuuhhggF5v6F&v6DF~|Ě_}hhgg6VB)6)DŽ؋6)DŽwFvDŽDŽF~|hh.__66hh8V_66hhEV_hh hhKI_hh6hhQI_hh"hhVI_6lOhh]FPo FPFPFP_ F=~bvFP;_F>vhheFPo v6fOhOt4FPV_FءlO;FFN6WۣLNPt螇67thh666枚opNuLtC6N6L66枚o6枀~<6ŴvD t&_w6_DD)u3˸؋6)؃t؋6)؋ڣT8FFvthhvvEhvv_}m~uء);F|wؠD2`؋6)؃u)th_h׊l_w6_wum0_h_h׊hhF@PoDDFVu~t vF;vvhh"oˋvv ^ t4vvoFvv ^ 4uvvoF;FuvvvvV_Fhh"oFvv:oFs~u ~uHvvoF~ u ~ uFv v oF~} ~}v<\uFv<%tvvu_vDFu~} FFBF@PoDDFVu~uhh5"ov v vvo~u~~0|:~94T8|Zk6T8 F-0؋FF~!}&~~~F7ytFPoDDFF؋FꯋF6v<&tMvv2_6T@vv66ɧ_ =~vvu_FFPFPvv_ F}fvv_} vvu_n`v؋FVutȃ~~IF@PoDDFVuuvvhhM"ov v vvo FFvv^FFD3Vvvvvokv 6FFD~F@PoDDFVuX~uRvvhh"okv 6t4:okv 6Dv v vvo FFkv 6FDFDkv 6DT@FLF~}Ckv 6Dut%kv 6t4vvo~uAkv 6Du uءT@FFHk 6Tkv 6TFHk 6TDkv 6DTFHk 6Dkv 6DNF;F~dF@PoDDFVt~tvvhhg"o<~u ~u_v<\uFv<%t4v<&tFPFPvv_ |vDFuFF؃>T8~Y~0|S~9Mk6T8 F-0؋FVk6T8 F-0DŽDŽC~!}~~~F؋쯋ꯉFVFDŽDŽ~u ~uGvv:o6n`v؋FVuuv渇؋;F}vv^Dut.vv^t4:ovv^D6T@vv66Ȧ_ F} Ff`kv 6Dutkv 6t4:okv 6DuDtkv 6tt:oFFF@k 6Tkv 6TF@k 6TDkv 6DTF@k 6Dkv 6DFءT@;F~_T@k6T@ 6Dk6T@ 6DDk6T@ 6D3T@FHkv 6Dkv 6DDkv 6DF~|FEvDŽDŽFkv vDŽDŽF~ |F~2|FvDŽDŽF~~|F*vDŽDŽv渇DŽF~|U؃>)})wr6)؃tw؃>6ut>w؋6:ow؋6DŽDŽw؋6xvT86T8DŽڷDŽܷ؋6T8Fut@؋6T8F:o؋6T8FDŽDŽT8) T8؃>)}+hghmhghleWi~gwءP*$W؃>)}3ˡ)U_u_=w6_3F=t)=tZ=u=t=t~t wuhh4hh,wj4w uhh"oww j,W˸w ṭw j˸ Fv11WDD=|vvhh"o3Uw66w66hh$"o wt6hhA"ow66w66~w66oPw66w66~0o tEQRP"o w6Z6Xw6V6Tw6Z6XoPw6Z6Xw6V6T0o uWRP"o w66hhg"ow6t 6r hhl"o6767w66hhq"o 6O6Ohhz"o6U6Uhh"o6j6jhh"ohh"o˸b1Fhh"ohh"ohh"ohh"ohh"oFhh "oFhh"oFhh:"oF~uhhY"ohh`"ohht$_hhz$_hh$_jhhhhꞚo hhꞚ$_hh$_hh$_hh$_hh$_hh$_hh$_jj$_hh"oU~t]k"_F}Dhh"owءP$WDDj&WDDFwءP*$WDD~}hh"omwء!Fvhh"ov6Dut/hh "ov6TFVN hh "ov6F< r~t~w ~v~sF2Phh "oF2PF2Phh" "oF:Fuhh) hhB "oY ~tjjFPhhs hhD /_F=u )~}F.vvhhꞚok"_F}u%Z6T@vv66Ȧ_ F=u=t=tvvhht hhꞚoFZFءT@;FQ vhhkv 6t40o u9kv 6ttkv 6t40_} Fkv 6ttkv 6t40_ hh "oZFf k"_F|#F-|=chh"oˋFd_K _C ؋6)渇hh hh "ow؋6XTRhh "ow؋6\TRhh "ow؋6PTRhh "ow؋6RTRhh "ow؋6TTRhh "ow؋6ZTRhh& "ow؋6^TRhh> "ow؋6`TRhhV "ow؋6bTRhhn "ow؋6dTRhh "ow؋6fTRhh "ow؋6VTRhh "ow6:hh "ow8t  RPhh )t  RPhh "o3}w؁>uPhh "ow؁>"uPhh0 "owta g RPhhM "owt  RPhhn "owt  RPhh "o(t  RPhh "ow؃>u 6؋((RPwء5@2P6hh "o wt# & RPhh "ok_cFFwءP;FIvwB@^_RPvwB@hh* "o FF=~lguFFFwء ;FvwTRhh8 "oFFZF!؃>T8~x6T8hhr "oF~ |kk6T8 vut.k6T8 vvhh "o Fhh FF{ b_w`t  RPhh "ow`t"w6dw6bhh "ohh "ohh hh "oW_hh "oN\_hh "ofghh __hh 7t5 8 RPhh "o؋6)渇BtQ T RPhh< "oV8tm p RPhhX "o؋6)渇t  RPhht "o؋6)渇Vt  RPhh "oP8t  RPhh "o6R8hh "o؋6)渇6t RPhh "o6Jhh"o7tJMRPhh5wtahRPhhQ"owtRPhhm"ohh"ou hhFFO_hh"ow6b6`NWw؃>u6؋((RPw65@2Phh"o O_hh"oWFV|shh~u~"uhh"ovvhh#"o]_wu F(F0>u F,F>u F/F F4Fvvhh<"ow؃>u/wt6hhI"ohh["ow*thhNhhk"ofgchhhh_JL_CԼ*¼似¼ ܼ#9x=PQŞż)~ r~t ~v~sF2Phh "oz}hhzF2PWo6zzzF2vFFuhh "ovutTFFuhhA "ovhhT hhꞚo vhhꞚ0_| F~~|~thh[ zvutG~uhh "oFv渇ⱃ~u@F`Phh "oF~|~tshh "ov< }v4@2Phh vPhh"oFvuhh"o7t67hh"ohh"o7t(RPhh"o7t67hh,"ohh\"o7tRPhht"o7tRPhh"o67hh"o$FءT@;Fkv 6ttkv 6t40_}w*thhNhh"ohh"oFء [;F~pv؋,Zw;uzhh0v*Z(Zouhh8"o!v*Z(ZhhM"o:[txgRPhhP"oFYF~u ~uavvhhV"oZvvoF~ t~ tF ]F ~(uF~)uN~}F~,ug~uaz}hhzj,Wo6zzz,2z}hhzj-Wo6zzz-2F z}hhzF2PWoF6zzz2~ uBz}hhzj Wo6zzz 2v < tFqF FF=O~jz}hhzj-Wo6zzz-2z}hhzj Wo6zzz 2FZ~}%؃>Z~lgtkFZv F FtGz}hhzj Wo6zzz 2ZZ=~lgu˸Z3UwjtRPhho"owjuXwtRPhh"owtRPhh"owtRPhh"owtRPhh"owtRPhh"owtRPhh"owt25RPhh""owtKNRPhh9"o3UFvt v:F uv:F uFV33X 67yuݸ6=-u~=(ul=#uM= t ?=tE0)uvPhhR"oN=!t[n=%tT=$tM`=&tFY=*t?=)t8K=+t1D=@t*=<t#=/t/=>t(=|t=^t=~u؋6q6؊7ytF F҉FV)u6Phhp"oy_67yt6Po 6vF6؊7yuv67yt6Po 6=ht=ot=qt=tu=xuFFF҉FVvu v-0F= ~n'F;F|Fۋ\o؋ʋFʸ؉FFtFFF~ |~ s33˃~~| ~rFV؃FVF V %uteF^F V %utFV^N\oFVF V ؉F V u~ tFV^N\oFV~ u~ uF^N\o?_؀>^uKءFVy_ڢG_66vva_ۣFVotFy_ڢءFVG_F=%t)=&u=*to=/u;uu뀸؋FV~oۣ؀>*uq>/ug>%u]>&uS˸ء^N\o문ء#F#VFFFV^N\oFVn^~|ك~wӋFVUG__F~|~sFV؃FV~ |~ sF V ؃F V ~u~t ~ uz~ utFVF V (~u~t~ u~ t1ҋNˋFVF V NFFV؉FVF V ؉F V FV%^ N  хut~u ~ud~ u ~ uU~u ~uF~ u~ u7FV؉FVFV%utF V ؉F V F V %utۋFV;V +|;F s$FFFFF FF FFF FF F V )FV1ؠFy_ڢءFV_F=#u=+th=-tw=<u=>u=@u=|uء F VۣؠPhhG_tatZ˸ءFV븸ء^N+ʉ뤸ء3F3V넸66vv_f؋FVPG؋FV1(U__Uy_ڢ$_؀>Et&)uhh"oء؋FF3_FVFFvvhhvvo tˋFVU츇؀>Nu'ءۣy_ڢˀ>(t()uhh"ošy_ڢ$_؀>)t)uhhU_؀>!u.y_ڢ66_ۣ؀>-t>~uMFy_ڢ_~-uء؃ءң˚_~?~ ~`}F ~`}~z~n`F؋FVuuF渇؋ⱉFF5vv^Dutvv^t4:oFF;F~ÊF:oFDŽDŽF渇DŽ~t|F@PoDDFVu ~uˊF؋FFF渇؋FFvv^DFF;F~3Xv3v Fvv^<]tFvvo;F܃~~vvhhOFPhh%BjvvFPo Fӌ҉FV~\u ~&uFv<&tFPhh"ovDF)R~)hh"o3ˋ6)渇DŽ؋6)渇DŽ؋6)N渇؋ڋ6)溇ډ؋6)N渇؋6ڋ6)溇ډ6؋6)N渇؋Vڋ6)溇ډV؋6)N渇؋Bڋ6)溇ډB؋6)N渇؋ڋ6)溇ډ؋6)DŽءT8ڋ6)ډ؋6T8DŽDŽkv 6t4hhV_%FF0ڢhhu_F~ |jjj v v_ @FFvTFVv TFVFv< tv<{tFFvvFFFv< t؋^\FVvFvFuNLv)Fv,FvFvFuNFvF< tNvvFFvtY؋^\FVv<{uFv<(uFv<)uNv<}u&Nu!v)FvvFFv.v<,t|~ts4vFvFuNvFFDv FFD~t3h_h׊FP6N6Lhh"_F|~uhhN"oFvvhhꞚoFFk"_F|vvT5Wuwvvlo ww6b6`NWwء|U_i~g7thh7_7)~u4~u.`vvhhx"o؋F`vvoF`>`Ovvhh|"oǐUjjjoO6Ohh/oUh_hjowء+иwF,O~hh +6,O%WF +,OFFڋ6,O*Ot ؁>,Ou;hh +6,O%WF +,OF3؃>*O|*O jm WDDF=}Fڋ6*O/WF~Tء*O+;V} *O+ЉV66vYWF~OFF*O ؋62F*OF˸w*uhhODk%Whh+Q7w2|s(wuwuhhO"oXw}Kjwt wءwءPhwh*hhN,W }hhNhhOOw(thhNhhO"ow؃>|>v66hhP"ow؃>uEP6؋((RPw65@2PhhP"o hhIP"ohhP"ow t?hhhhP"o)tPPRPhhP"owthhP"ohhzowءP$WDD|g O6Nw66WF| O Wj WDDjwtwءhhPwءPhwh*hhN,W },hhNhhQhh /o hh /lo3˸6Nw66W}0oڣ(OjjjooF=uSk%WhhVQlow(u*NtNQRPhhqQ"ohhQE~tmw"Ohh/ĵotEOh_hjoh_hjoQOO=U)WthhQ"ojj*~gjjjojjjo&O3ڣ$OjoDD *O +,O^$OP~u$O<$OtNwء!F~ u6(t)v9_DDw t FP_F v9_DDw uFP_"OuOuOt6OOO2Fup j&WDDF~u j%WDDYwء!FOu(Ou v6Du_uYv62FOuYOuQF%w;u@j&WDD%FFP_؋v6TۣOOFFwuw؃>"u^Ft-&OuJjWDD2PWDD&O*؃>&OujWDD2PWDD&O~u &O~u &Owء"!F~ uBwt5j WDD2PWDDwt j %WF FFF2PWDDPWDD=~~wuwtv kgDDRP%W FP%Ww uFF)u ~ uF FP_VhhQlo"O:j vojjo؃>Ou O؃>Ouk%WO~!>O~!g=} WOOtw6j*~gw(u*NtNQRPhhQ"ohhQ"ow(Oj_DDF=}Nw(u"hhQ"o~uhhRlo Wj6(Ooowt/v kgDDFVvuyvFP9_wء"!Fwu ~thhET%WNtN]TRP%WhhqT%Whh.O%WhhwT%Wj&WDD%F=\thhTA&WFFw;uF7ytFPoDDFF=@t;~= tr =u =u =u=0tMe=!tk%Whh:UOWwءP$WDD}hh;U"o"OFF2PWDDFF=?t=_F=lt.~=ct)=bth!W뱸"OhhTT!W=ht?O"OhhT'OO"OhhT%W?=st ~=qthhNwtTTRPhhThh /ohh /%Ww|.r$66hhThh /o hh /hhTA&Ww؃>uPw؃>"uPhhThh /o hh /%Wwء=t*=et-=mu=ou=su&hhU U)hhThhTA&Wwuո&URPhhUhh /o hh /A&Ww thh-U%WhhA&WwtfghhTwhh Un=zu'jmgF2PWDDFFPW~\u} j&WDDw#F< t~ t؋6Fɸ6 hh/0_F=|`j%WUw t_)u~ tLFtF~t@~t:FPj 0W}'hh[UA&Whh\UA&Ww ːut6DuDthjoۣȉȸ6ȋF F ~u~u F&mFv v |WFPv D Pvvo ~|TW_=u33˸؋rr6ȉD8T:6D(j6rD@@Po6ȉDTj6rD@@Po6ȉDTo6ȉjjo6ȉ6Ŵ6D6D: oءȋU6rDt؋ll6rDuhwhr"o˸66hhꞚo螇hwhhh66_ ڣ|~Etk"_ڣ|j 11WDD=}hwh"oh66j .Wڣ|.6666枚V_|3j ,WDD66枚u_)3h_h׊hh~Vuw wRPhwhV_ڣ}jPhh7D_6<{uL66oHڣ6<}u؋6666_~6uwءP*$WDDj w6_DD<>u5hwh#"ow6_k"_ڣ|)th_h׊l_~Vu^h_h׊hwh"hwh!62t΃~6uhwh"o}hh7_ء6u1hh7_66枚u_ظ)6666枚V_ڣhh7_}Sjjhhhwhhwh/_ڣ}?>thwh"o FPhwh"o)3˸6<\tF\j66F j66FPo hwhhhFP_ ڣ|Jh_h׊hhj hwhhwh| _ڣ|k"_ڣ| ~9u O3wڣhh66FPF_ }ظ)~Yt~Xuh_h׊hhhwhhwhjjhhhwhhwh/_ڣ}>tthwh66FPoF҉FV~\u~%t~&uFv<%t v<&thwhhhvv蚙_ ڣ}>ujjhhhwhDhwh->t1hwhhh66_ ڣ}؃>`uhwhE"o˸w66_|jjhhhwhhwhjV_ڣ|*jjhhhwhhwhV_ڣ}낸6<{uQ66oڣ~16N6<}u؋6N66uvvu_~7t~XuGF 螇FPhh枸66׊_ 66vvV_ڣ}:~7t~XuwwRPhwh"o)3Q~Xt~Yt )4(FFF~u~tj~ u~ t^vvoF=|HFJ~tAwu.w(u!6U6Uvvhwh"o 33F~}v v ΥoAF;F}6~u F;Ft%vvvvvg twu4w(u'vvvvܸ6U6Uhwh"o~u~tov<=tgvvŒoFV 1ɚoFV|>~v6v WDD}vvhwh"ow؋FV~u~t6v<=t.FPjvvhwhjҚ(3_F=~ w؋FFVv v h hhꞚo uut h66hho k"_ڣ|̸螇hwh oFVuuw؋fdFV66vvhwh66枚ohhꞚNWظ)5U~@u3ڣF-}`=~X.cءwڣXwڣVwڣTwڣRwڣPءwڣdwڣbwڣ`wڣ^wڣ\ءwڣfءwڣZءwڣfءwڣPءwڣRءwڣTءwڣVءwڣXءwڣ\nءwڣ^\ءwڣ`Jءwڣb8ءwڣd&~]]'9Kh_h׊hhhhhwhhwh _ڣ}$>uhwh"oˡh66hho 66w6^6\hwhhhꞚok"_ڣ|hhꞚNWhhi1WFVu ~u3ڣ) )t8)twwRP66hwh"o ء)U؋6)渇uhwh"o˸؋6)渇uZ؃>T8 w؃>~_kw6_DDhwh"o)t@h_h׊l_0jjhhhwh+hwhV_ڣ}\3W jjhhhwh:hwh,/_ڣ}>tFhwh;"ohwhhh66_ ڣ}螇hwhT66枚ohhꞚo枋螡枉FV6<\u؋6ڋ6枎螈uָ枋6枎 h_h׊FPj hwhihwh[| _ڣ}266o=}؋6ڋ6枎螈uָ枋6枎 h_h׊FPj hwhvhwhj| _ڣ}66o=}|؋6ڋ6枎螈uָ枋6枎 h_h׊FPj hwhhwhw| _ڣ}>t3hwh"o"vhwhhho 66o=|؋6ڋ6枎螈uָ枋6枎 ؃~}6枎<6枎>؋6枎 jjhhhwhhwhV_ڣ}66o=| hhhhs_}hwh~uhwh"o6T@hwh66Ȧ_ ڣ}bhh hwhI_6T@hwh66Ȧ_ ڣ}hwh"o)3vv6_ڣ)Uw66w66w66hwh"owt6hwh+"ohwh/"ohwhZ"ohwh{"ohwh"ohwh"ohwh"ohwh"ohwhL"ohwh"o~>uh_h׊hhj hwhhwh ~umh_h׊hhj hwhhwh| _ڣ}}F=t =>t8=]uTk"_ڣ}h_h׊hhj hwhhwh둸w%6"Wˡw h_h׊hwh,hwhw6hwh_ڣ=t }믃~]tUj&Wj~>u9wt,'WF=|cwء#F;uظ)\joءt$c&Wڣtءtw~>u )؃>u3ڣ)3Uh_h׊hhhhhwhu7hwh=hwhthwh^"o >tѡ˸66hhꞚohhꞚo잺ڣh_h׊hhhwhhwh~ _ڣ|6666ok"_ڣ}_66hhꞚ=WAT8}!6T8hwh"o)3˸螇F FPhhvv׊_ =~ FFvvoF=~wF@@PoDDFVu~t5vvvvo؋6T8؋FFA؋6T8DŽDŽF؋6T8DŽDŽ_~t3ڣ) h_h׊hwhhwhw6Fhwh_F}&~uhwh Fhwh"oˋF=u5=u-=t0=uW=tj 11WDDhwh:`hwhXj 11WDD~hwhCh_h׊FPFPhwhhwh _F} ~u\~thwh"o=vvhhꞚohhꞚo=}k"_F}hhj }*W~h_h׊FPhwhohwhSV_F}~thwhpvvhhꞚohhꞚo=}k"_F}hhj 6Wj 11WDD~h_h׊FPhwhhwhV_F}~tDhwh4vvhhꞚohhꞚo=}k"_F}hhj 6Wڣ)u! )thhhwh"oء)h_h׊FPhwhhwh _F}~u hwh~Fj 11WDD~ hwh,3  FvvhhꞚohhꞚo=}k"_F}Fhhjjhhj X+Wڣ)hwhMrwL^NwFw6Htw؃>؋6)؃tehhh≚u_}hwh_"o_0_h_h׊hhhwhhwhV_F}6<{u?66oFN6<}uvN666hhꞚowHJ6Hu hwhhhꞚo랺ڣ螇wLNwhhh≚u_}_؀> }0_h_h׊hhw6J6Hhwh:)~6)؃thFFhvv_}hwhC0_h_h׊hhhwhhwhV_F}@6uhwh"oˎ6<{u?66oFN6<}uvN666hhꞚowHJhhꞚoF랺ڣ螇 +FHڣwL+Nw666枚_=6枀< }66枚oFN6枎螀< uvN6枎FFvhhFP66枚׊_ t{0_hwh,hh≚ojjhhhwh5hwh. _F}p6666枚o؋螡枻wۣLNFjPhh7D_hwh6_w6_DDF)t3h_h׊l_#h_h׊hwhHhwhjhwhSV_F~t׃~}w6Hu6H<{u?6J6HoFNw6HJ<}uvN6HJH6J6HhhꞚowHJhwhx_w6_DDF)t~h_h׊l_nhwhk"ohh7_3~uhwh"oFhh7_h_h׊hwhLhwhhwh _F~t׃~|Fk"_F~thh7_~uEh,w6J6Hhhjo wDrw*twnWF k"_ڣ} ˃~Tt~Uu؃>T8}0F%F0FF F0FFF~Tuc؃>T8uF؋쯋T8HHk v؋FVu~vvFPV_~UtW؃.T8T8@@k v؋FVu~ءT8@@k vFPV_؃T8hghmhghleWF~ })3LvvoFv<:t=FFvNv^vv^N~v:Fvv^v|.tv| t vDuvvhwh"o)uhwh"o))6)؃uA؋6T8؋F‰Vvvšo+F@FFF,؋6)؃uFw؋6xvΥo9vvhwh2_tBvvhwhF˚"o3w؋6ŴvD tw؋6xvh hhꞚo uuFFćFv€< tv€< tv€<:u؋F£FģF6u hwhOQˡ-} =~ .3w؁6넸)u)tqjjFPhwh{hwhd/_F}~t* hwh"o vvo=} Fv<\tvDFuF7ytFPoFF<%t!~&t~$t~Vt~Mt ~FtcF 螇FPhhvv׊_ hhꞚoF=6T@vv66ɧ_ =i~g؃>u)t)uy3F;؋6)渇~3F~Iu؋6)渇؃h_h׊FPhwhhwh|/_F}~thwh"ovvi1W| ~=v3F؃@h_h׊FPhwhhwh/_F}~thwhvvoF= ~ hwh螇vv66枚oh_h׊FPhwhhwh/_F}~thwh vvoFFF@@= ~&F@@螻ۣvv66o؋6)渇Vt$6666枚o3F;F~FFP6666枚g Fء=t= t"= t~ ~t~|}h_h׊FPhwh=hwh/_F=u hwh>~}螇vv66枚ojhwhR66枚g u,؋6)渇؋?؋6T8渇؋R)jhwhX66枚g u;wءFh_h׊FPhwhhwhe/_F=uahwhjhwh`66枚g uj66枚y2_u$66枚tou~}7vvo=}66枚oF잺ڣvv66ojhwh66g u,؋6)渇؋?؋6T8渇؋R)jhwh66g ubwءFF;F}؃> uF;Fu؃>uF;F~؃> ut3F؃jhwh66g uC66y2_u66toNh_h׊FPhwhhwh/_F=u hwh~}F螇vv66枚o66枚y2_-8.2,,,B,v./0/0/0v.v.8-3-wt~u3FF=-u=IuX=JtjjFPhwhhwhV_F}FFFF螇hh枍FPs_}P~t#螇6؋6)渇DŽ~tr؋6)渇DŽ؃>T8 w؃>~_bw6_DDhwh"o)u4h_h׊l_#؋6)渇DŽjjFPhwhhwhV_F|FFFv< tFv< tvt$u6T@hwh 66Ȧ_ F=}Ehh6hwhI_6T@hwh66Ȧ_ } hwhhhv_Fv< u hwh*6 6o6 6ovڋ6 Fv<{tvuF:FwvFڋ6 ujjFPhwhWhwhHV_F}FFFFF螇hh枍FPs_}u6T@hwhX66Ȧ_ F=}Xhh"hwh_I_6T@hwhf66Ȧ_ }hwhm"o)hhꞚoFhhoF@@PoDDFVu~tLhhvvohhvvovvv_vv:o3hwhXFv< tvu0Fvv6DFF~|jhwhFPg uhh枍FPs_|FUhwhvv ow6ۉvxu)u%vvlo)w)>)R~!)hwh"o)3˸w؋6ut!w؋6:ovvo@PoDDwۋ6ۉut'vvw؋6o؋6)渇DŽ؋6)渇DŽ؋6)N渇؋ڋ6)溇ډ؋6)N渇؋6ڋ6)溇ډ6؋6)N渇؋Vڋ6)溇ډV؋6)N渇؋Bڋ6)溇ډB؋6)N渇؋ڋ6)溇ډ؋6)DŽwءڋ6)ډ*h_h׊hhKhhJjhwhҚ_F} FF˚k"_F|vFU~ u#hhN"oIvhhx"o6~ u:hh؃>މuuvRPhh`"o F ˃~ |~~F ;Fk"_F |vF U~ u)hh"ov hh"o˃~ |~ ~~ uؚk"_F }F vF h_h׊hh hhv v V_F}F˸6 <{u?6"6 oFN6 "<}uvN6 " vDutvt4:ovD6"6 oF~3F@PoDDvT6"6 vt4o vDظ)Uh_h׊hhhh6hh_ڣ}-}= ~.AhhU hhhhU hhhhUSt6"6 oڣڣ~T6 <{uF؋6N6 "<}u*؋6N6 " ؃.~&LhhU;gHh_h׊hhj hhhh| _ڣh'66hhUX;g ڣ)hhUhhU;gڣ|=hhUshhUjh_h׊hhhh hhhh _ڣ}C>tUuUt6U6U:oUUthh"o6"6 hhꞚok"_ڣ}UuUt6U6U:oUuUt!6U6U>0?8?X?qAqAqAj?=a?=%؋66 "<%u؋6F6 "t4hhS"oh_h׊hhhhtw6hwhњ_ڣ}-}=~.Gh_h׊hhj hhhh| _ڣ}؃>t>thh"ok"_ڣ}d؃>tw$؃>t果螇hh oۣ "6"6 66枚W=|6"6 hh"o)3>u w$ظ)zh_h׊hhhh6>hh_ڣ}Nk"_ڣ| ^ءڣ(h_h׊hhhhjhh_ڣ}k"_ڣ}~tVء+Rhhhho hh&hhhh"hh_u;[8ءwڣjhh'hho h_h׊hhj hhhh*| _ڣ}5k"_ڣ} ~tI6hh=hho hhDhhhh@jShgwڢDD2ءwڣh_h׊hhRhhEw6XhwhHҚ_ڣ|sk"_ڣ|y~tءwڣ]RPhhW`h_h׊hhzhh`6hhN_ڣ}k"_ڣ}ءwڣ~t-6hhhho hhhhhhu w&w؃>tw&hwh&;gw&twwvj 6_hh"o DZFG|DGGEGGFGGLCGGUh_h׊hhhh6hh_ڣ}=tx=u=u=u-= th_h׊hh hh jhh_ڣ})k"_ڣ}+ءڣ(h_h׊hhj hhhh| _ڣ}؃>t=>t6hh"o)3J؃>u!w"&k"_ڣ}>u w"ظ)hwhhwh;gڣ)h_h׊hhhhw6hwhҚ_ڣ}뤚k"_ڣ}뎸ءwڣpu~ uhhhh2hhꞚo~tQh_h׊hhQhhꞸ6Phh@_ڣ}T>thhR`hh5 Wh_h׊hhvhhꞸ6hhR_ڣ}=u"=u=u=u=u=u;=t~ tj hh!FPo h_h׊hhj FPhh!| _ڣj^66hhX;g ڣ}~u^6hh!66o hh!66hh!N6hhO 66o hhV 66hhR jShgwڢDD2h_h׊hhj hhhhw| _ڣ|ak"_ڣ|P؃> ~>?|>_~R>}K~ u/wڢ-~ tءwڢiwڢظhh"o?h_h׊hhj hhhh| _ڣ66hh;gڣ}2؃>~ uwڢhhvwڢءڣ)h_h׊hhj hh2 hh | _ڣ~ t w666hhX;g ڣ}؃> }~~t>~w66w6&6Wڣ;tJءwڣ)u- )t w6&6hhW "oءwڣ؃>^~^wڣw6 66hhX;g ڣ}t؃> } hh >~wڣw64w6&w6Wڣw;t:)u- )t w6&6hh "oءwڣwڣwڣw)u)t؃>^~B )t5hh "ow؃>H}؁>~hh!"ow~.| v!Wwۣ h_h׊hhj hhR!hh2!| _ڣj~66hhX;g ڣ}~ tءwڢءwڢh_h׊hhj hh!hhT!| _ڣj^66hhX;g ڣ}4~ uءwڣFءwڣD h_h׊hhj hh!hh!| _ڣ66hh;gڣ|ءwڢءwڣ>h_h׊hhj hh!hh!| _ڣ=u#wB wBj^66hhX;g ڣ}ءwڣ@wڣ<:Uh_h׊hh!hh!6Lhh_ڣ}-|g=b.Th_h׊hh hhE"hh!V_ڣ}6"6 o=2~j2hhF""o˸6"6 hhogh_h׊hhj hh"hhh"| _ڣj66hhX;g ڣ}ءڣ7ءڣ7hh7hh7;gڣ)Ch_h׊hhj hh"hh"| _ڣj66hhX;g ڣ|v\hh7h_h׊hhj hh)#hh"| _ڣh66hhX;g ڣ}ءڣ7ظ%^SSSRSTS[TZU)thh+#"oL~}FR~uNhhO#~uDh_h׊hhN#hhM#6hh_F|jv6_ˋFF-}H=~@.[h_h׊FPhh#hhi#V_F}FFČ҉FVhh#vvvvjCh_h׊FPhh#hh#V_F}~thh#"oKw*tnWjERh_h׊FPhh#hh#V_F}qw*tnWTghh#hh#vvjDk"_F}4hh#hh#hh#jHhgwڢDh_h׊hwhHhh $hh#V_F}w6J6Ho=}~thh $TgwDcc$hh &hh &vvjWhgwڢD2Fh_h׊hwhHhhF$hh,$V_F}Nw6J6Ho=}~t+hhG$cwDkk2FTgPh_h׊FPhhp$hhh$/_F}vvo@PoDDFVuuhhq$phh$hvvvvoh_h׊FPhh$hh$/_F}nvvo@PoDDFVuuhh$"oRvvvvoh_h׊FPhh$hh$V_F} ~tvvo@PoDDFVuuvvvvovvvvvvjIhgwڢD~u~tvv:o~u~tvv:o~u~tvv:oFk"_F}0hh$hh$hh$jIwt wju hh$wH%JwL%Nh_h׊FPFPhh,%hh% _F}~thh-%vvhhꞚozh_h׊FPhho%hhN%V_F}Pvvhhzohhzo=^~ hhp%awwHJDwDsw*uwh_h׊FPhh%hh%V_F}hh%hh%vvjUh_h׊FPhh%hh%V_F|kvvo=} hh%TgjTvv*\gh_h׊FPhh &hh%V_F|j k"_F}Fhhhh &"ozUU1VVVSWWY[[[Y[[Z[:[[w*tnWF;Uvuhh#&"o3hhB&hhA&vvF Phg2h_h׊hhZ&hhC&6&hh_ڣ}hh[&"otFP;gڣ}~uw؋Fw؋Fw؋Fw؋Fw؋Fw؋Fw؋Fw؋Fw؋Fw؋Fw؋Fw؋Fw؋Fw؋Fw؋Fw؋F>t >tk"_ڣ}؃>u3wڣj~tFhh&jt}&&RPhhy&hh&u& )h_h׊hh&hh&jhwhҚ_ڣ} ءKk"_ڣ}4ء-}v=~n. a~tChh&t&&RPhh&jShgwڢDD2ءwڣwڣ:~tءwڣwڣ&RPhh&뗃~t,hh&t&&RPhh&eءwڣwڣ~t,hh&t&&RPhh&ءwڣwڣl~t,hh&t&&RPhh&ءwڣwڣ~t,hh&t&&RPhh&~ءwڣwڣ~t,hh&t&&RPhh&1ءwڣwڣ~t,hh&t&&RPhh&ءwڣwڣ9hh&"o_%`>_ a a a a_ a _^ a ar` a`_oUh_h׊hh&hh&6Phh(_ڣ} ˡ=tk=u=u=ub=uJh_h׊hhj hh'hh&| _ڣj66hhR8X;g !3h_h׊hhj hh&hh&| _ڣj^66hhN8h_h׊hh&hh&jhhR_ڣ}k"_ڣ|`ءڋ6)溇ډ6dh_h׊hh&hh&jhhb_ڣ}k"_ڣ}ءڋ6)溇ډVظhhP8;gڣ)c~,thh'"oFꞺڣ6"6 hh-(66o 66lowءwڣ*w66hhNoWwۣw)3˃~th_h׊hh w66hhA'V_ڣ|6w*tnWj WDD6 t-뇸w؋ۣ "wءڣw}/؃>~ wڣ w؃>~wڣww6w6hh6"6 ,W ڣ|>u*hh['"ohht'"ohh'"o2>uK6"6 hh'PhhꞚo@@F +F=d~6"6 hhN(>u6"6 hh'"o>t"wu6"6 hhp(̸6"6 hh(뷸؃>~ wڣ*w}3wڣ6"6 hhNoWwۣظ)gUF=t4=et=mt"=ot=su()˸))))޸)'WF=t=t=u hhJ*hh)hh'*"oFt**RPhhf*"oFt**RPhh*"oFt**RPhh*"oFt*+RPhh*"oFt'+*+RPhh+"oF tO+R+RPhh.+"oUUU~u~u FV+Fvvjjjj wg jjvvhhW+j~gwء Pj*~gvvoF v vvF @v PoFF @V F"FvFFvvtXvvv vZhgFVv t6vvvv ZhgFVvtvvvvZhgwH"JgF$)u")t6$)6"):ovvo@@PoDDۣ")$)u9")u13+vDŽ$^+DŽ&bO$dOFh,vvhhjo FFFF؋$)")FVFVFFv< tv< tvvoF~vNv^< tvNv^< tvNv^NĊFvFvvFFRv< tvu2vFv؋F$F&Fvu6vvFFv<\uFP/0_F=ylFv< tFFFFF$FfFtv~Ff~ }v^FF5@3~u*v^Fv?FvF$FFVˊFv2vFPNo=~v FPvvo vu6hh_+ oFVu~tv vvvvo v Nv^Fhhd+"oj&WDDFF=YtK#=Nt*= t== t6I= t/B=Qt;=qt=nu/hht+"oF(=yuhhk+"oFhhw+"o~}fFUj,WDDj,WDD(t:hh+jjjjwg hh+"o*Wjhh~Wo3hh+wuJhh+"ow؃> th_h׊l_މthhhh+k%Whhzow6'WDDF=}hh+"ohghmhghleWwء=tV= ubwءP*$WDD)t/h_h׊l_މuhhhh+"o3˸wءP$WwءP*$Ww*uw(tc&WF=}j&WDDF}F%=Zu~=uoJ=ue =u =u=u= u = uy=un=Eu=AtZ =u2R=Bu'G=Ru =Fu2=Xu'=fu~=bu~s=at؃>(t >(thh+jjjj wg hh+jjjj wg wthh+hh,jjjj wg hh,6DO6BOjjwg NuNthh,6N6Njjwg hh,6XO6VOjjwg N|PNvFءVOXOd1ɚ\oۋNNoFVhh,,vvjjwg w؃>Ju&hh:,jjjj wg hhI,jjjj hhV,JRPjjwg hhc,wء\RPjjwg hhp,wءPRPjjwg hh,wء~RPjjwg wuhh,w66jjwg w؃>uhh,wء>t>uhh,wءRPjjwg hh,wء$RPjjwg =et2hh,jjjj wg w 6hWDD=xt *=rtKhh,jjjj wg w24=zu#hh,jjjj wg w4 jjlrg3Pwu$w(tw,t$w8u~|~~vFc&Ww,u ~u~t,u~~| ~rw6 kgDDRPhh,FPo FPjjjj wg hh#-jjjj wg hhR-jjjj wg hhy-jjjj wg hh-jjjj hh-jjjj wg U&)()*),).)hh-A&Ww؃>uhh- >uhh-%Whh,%W|thh-%Whh|A&W,|؃>N|?>Nv66N6Nhh-hh,o hh,%W,hh-%Wwthh-hh-A&W؃>(u'hh.A&Whh!.A&W&)0)<&)tsg؃>(t"WFԉVָw؃>u wءwء@FȉVFFFugNu Num>N|1>Ncv(NNd1ɚo؋ʸءVOXOo33҉FЉV҃|~dv FdF~#|~dsءZO\OVOXO ءZO\OFĉVƃ~|~vFċVƋ^ԋN֚o33҉F̉VFt~u~uءVOXOF̉V΃~|>~v6vvvvvvи6XO6VOj hhA.FPo.vvvv̸6XO6VOj hhW.FPoFP%W0)˸ءVOXO+()*)|=rٸءVOXOۣ()*)ءVOXO1ɚo+,).)FVFFFV;V|;Fr|ء0)0)=M~hhm.A&W0)j.%WDD؃,).)FVTw*tLwءFjWDDwu+~t%wءP*$WDDhghmhghleW~ t`~ tZwuw(twt(uw,t w8t{؃>(u'vvv v FPvg Q.6|vvoFF-|=~hh.jPvvhh,o &)jPvvhh|jPvvhh,o ֊F-}e=~].zjZugDD؃0)0)=N~hhn.A&Whho.A&W0)؃>(thjZ%WDD0)Q؃0) 0)=N~hhu.A&Whhv.&؃0)0)=N~hh.A&Whh.A&W+؃0) 0)=N~hh.A&Whh.%W0)hh.A&Whh.hh.A&Whh.%W؃0) 0)=N~hh.A&Whh.bhh.YTyyyzMzczz~YuB~Du jugIء0)0)=M~hh.A&W0)~Zu؃>(uFP%Wj%WDDhh.hh.A&Wj?%Whh.A&WvvF0)0)=M~hh.A&W؋F0)vv%Wchh.A&Wvv%W؋F0)9F0)0)=M~hh.A&W؋F0)vvA&Wv v vvhh.FPoFPxy yy7yxz){;{U{l{{{| y yUw*tvvjjjj wg jjvvhh!/j~gwtwj,Ww tw j,Ww t9jjhhH/hh1/j~g̣w j,Wj ,WDDj ,WDDUuUt6U6Uu>"uhh0$W66hh0$Wjj66_wءPfgDDRPhh0$Wj j66_hh0$Wj j 66_hh0$Wjj 66_hh1$Wjj 66_hh1$Wjj 66_hh#1$Wj j 66_hh11$Wjj66_hh>1$Wjj66_hhL1$Wjj66_hh[1$Wjj66_hho1$Wj j66_hh1$Wjj66_hh1$Wjj66_w6 kgDDRPw6 kgDDRPw6 kgDDRPhh1$Wjj66_w6 kgDDRPhh1$W66W4)vvoFF-|=~"jj66_hh3.Qhh0H)J)jj 66_66gjj 66_66gjj66_66gw؃>u!j j66_hh2)>tj j66_hh(2$Wjj66_~9"vvhhF2$W؋FF)vvhh>2$WF9j j66_hh32zءF)F=:},F)Pj66_vvhhI25jj66_F)F6vvhhP2$WFF)؋F V H)J)jj 66_؃>J)|>H)vv v hh\2$W66gg=w؃>,|jj66_wءPfgDDRPhh`2$W66g66gjj66_w؃>Juhhc2$W6Jhhe2$W66gw؃>u wءwء@FءD);FtJjj66_vhhh2$W66g؋FD)jj66_w6,hhk2$W66gwء6;@)t^jj 66_w6&w66hhn2$W66gwء6ڣ@)wء0;B)tUjj66_w60hhw2$W66gwء0ڣB)F;>)tY~YtS~NtMjj 66_FPhhz2$W66gFڣ>)F=Dt}=Et =Qup=Su$P)R)33һۣL)N)0=Tt(jj66_hh2$W66gJ)} H)wء6)8)ۣ:)<)؃>J)|1>H)cv(H)J)d1ɚo؋ʸءVOXOo33һۣ6)8)3|>6)dw*؃><)u*>:)cu#8)|6)s 6)d8)ء6)8);<)u ;:)ujj 66_68)66)hh}2$W66g"Ww+3҉FV} ~w8)|96)v/6)8)d1+ʋFV\oۋ6)8)oFV|:~v2jj 66_vvgRPhh266Wjj66_hh2jj 66_Fu!6)d8)hh2$WOJ)|BH)v8ءVOXOd1ɚ\oۋH)J)oRPhh2$W66gjj66_66g66Wjj 66_66g66WF-}K=~C.Œ؃L)N)ءVOXOP)R)jj66_hh2-jj66_hh2 jj66_hh2jj66_hh2jj66_vvhh26jj66_vu hh2vvvhh2$Wgjj66_hh2=jj66_hh3hԑ?jj66_w~jءP)R) 1ɚ\oFVwء؋ʋFVo 1ɚoRP6R)6P)6N)6L)hh*3$W(6R)6P)6N)6L)hhP3$W 66gjj 66_wءRPgRPhhm3$W66gjj66_66gjj66_66g66WDW6)d8):)<)>)@)B)D)4)j%W(#jj66_vvhh3$Wj%Wjj66_vvhh3966gjj66_66gjj66_66g66W6)d8):)<)>)@)B)D)DW(4)jj66_vv8:!Ւڔ<.F )thhG"ow6j*~g3(F(~uhhGhh≚o؋6)渇؃u؋6)渇0_F2(-|=.)~Tt~Uuvp&gFF(~5t ~6t~Euvg'~Qu$k"_ڣ} ء';g'FuWk"_ڣ} ء'hhGhhGhhGjLhgwڢDw*tnW3p'~th_h׊hhGhhG6>hh>_ڣ} ء''k"_ڣ} ء 'tnW3ڣtG؁>}؋6ƄBո7B7u3ڣ)z&~*u:jjhhhh5Ghh GV_ڣ} ء?&3:&~u,k"_ڣ} ء& i_ڣ)&~u_ڣ)%~\uF4_ڣ)%~th_h׊hhQGhh6G6>hh>_ڣ؃>uhhRG"o%} ءj%k"_ڣ} ءN%6_ڣ؃>u3ڣ)ء)%~;t~9uvg$~t~7t ~Xt~Yuvg$~Gtjjhhhh~GhhsG/_ڣ}+؃>uhhG"o|$ءq$hhX8hh66_ ڣ} ء9$k"_ڣ} ء$6X8ءP;_}hhG"o)3#)#~St~(uv g#~ug#~u g#~uhhG"o#ء"k"_ڣ} ء"6vg"~Ct$)u-k"_ڣ} ء")"؋6)؃ugjjhhhhHhhGV_ڣ} ء2"k"_ڣ} ء"_)"؋6)؃uMjjhhhh,HhhHV_ڣ} ء!665g!!~2tT@uhh-H"ok!ء;T@|k6 6Tۋ6ۉءڋ6ډk6 6Dڋ6ډ]h_h׊hhHHhhBH6T@hh_ڣ}+؃>uhhIH"oh ء] h_h׊hhhhrHhh_HV_ڣ} ء& 666_=})3~ t ~_th_h׊hhhhH~ usHHRPV_ڣ} ء6<{u\66oڣ؋6N6<}u#؋6N6~_u!j66jhhH"o 66hhH"o~Dulg~tjjhhhhHhhHV_ڣ} ء6<{u\66oڣ؋6N6<}u#؋6N6؋66uC؋66u؋6N6<\tF؃>~Q؋6N6<\u5؋66<\t؋6Ƅ\؋66ڋ6ڈꞸ؋6Ƅء랺ڣhhꞚo +J؉hhhhhhꞚ׊_ })3>ء랺ڣ66J_ڣ)~t ~>t~]uvg~th_h׊hhhhhhHhhH _ڣ}+؃>uhhH"oءthhH"o^66hhꞚoh_h׊hhhhAIhhIV_ڣ} ء hhꞸ66DWu3ڣ)~3uBk"_ڣ} ءw6b6`NW)~t ~ th_h׊hhj hhSIhhBI| _ڣ})؃>uwءڣ ء-k"_ڣ} ءj6*~g~Ou0k"_ڣ} ءnWwDa3~ uWk"_ڣ} ءhhVIhhUIhhTIjFhgwڢDw*tnW3k~Hug]~ th_h׊hwhHhhIhhWIV_ڣ؃>t ؃>u ء w6H<{u\w6J6Hoڣ؋6Nw6HJ<}u#؋6Nw6HJwHgڣء~Vuvgڣ)k~th_h׊hhthh<*"_ڣ$_ءbp*c*V.I uhhI"oءxj266hhjo k"_ڣ} ء?j66'g~-t ~Jt~Iuv+g~t ~8t6N8hhIhho h_h׊hhj hhhhI| _ڣ} ء h_h׊hhhhIhhIV_ڣ} ء96<{u\66oڣ؋6N6<}u#؋6N6~u(666/i_ڣ)&666m_ڣ)؋6)渇6tT)uG_)t5)u(~uhhI"o~8uhh J"oء)~.uxh_h׊hhhh"JhhJ/_ڣ}+؃>uhh#J"oءk"_ڣ} ء3~th_h׊hhEJhh9J6h>hhP>_ڣ؃>uhhFJ"o,} ء6 T_ڣ} ءءڣ)~)uWh_h׊hhhhyJhh]JV_ڣ} ء66oڣ)s~twLzJNh_h׊hhhhJhh{J _ڣ؃>t ؃>u ءk"_ڣ} ء66hhꞚowLNwDvw*t w3~ueh_h׊hhJhhJ6N>hh=_ڣ؃>uhhJ"oH6Ug4~ug&~t ~tqwLJNJwڣHJh_h׊hhhhhhKhhJ _ڣ}+؃>uhh K"oءw66hhꞚoh,66hhjo ~tu9h_h׊hwhLhhAKhh,KV_ڣ} ءk"_ڣ} ءwHJw6Ltwt wjuhhBK"ozh_h׊hhhhtKhhaKV_ڣ} ءX66ouhhuK"o+66hhzohhzo=^~hhK"owHJDwDsw*t w3~Ptw螇h_h׊hhhhhhKhhK _ڣ};؃>u$whhK"o"ء؋螡枻wۋ6ۉ$&؋螡枉FV؋6ڋ6枎螈tԸw؃>u jvvoFhhjoF@=,}(vvhhjohhKhhjobO$dOwLKNwءڣgwDsw*twnW3 ~uCk"_ڣ} ء wDxw*t w3 ~th_h׊hhKhhK6=hh4<_ڣ؃>uhhK"oC } ء+ j66_ڣ؃>uhh%L"o ء ~uqh_h׊hhhhVLhhuL} ء k"_ڣ} ء 6uw6r6pNW<66w6v6thhLhhꞚohhꞚNW) ~"u,k"_ڣ} ء e_ڣ) ~1t ~0t4h_h׊hhj hhLhhL| _ڣ} ء h_h׊hhhhLhhLV_ڣ} ءd 6<{u\66oڣ؋6N6<}u#؋6N66t66hhL"o~1u__u3ڣ)~Nu+k"_ڣ} ء~jmg3o~$tw؃>~hhL"oFh_h׊hhhhhh MhhL _ڣ}+؃>uhh M"oءthh%M"o66hhꞚok"_ڣ} ءhhꞚ8gڣ)x~%th_h׊hhhhhhcMhhRM _ڣ}+؃>uhhdM"oءthhM"o66hhꞚok"_ڣ} ءء7PhhꞚN_ڣ)~&th_h׊hhhhhhMhhM _ڣ}+؃>uhhM"o<ء1thhM"ohhM oFVuuw؋nlFV66vvhhMhhꞚok"_ڣ} ءhhꞚNW)~4tk"_ڣ} ء[6T8w66)hhM"o T8}hh NhhN"o3 ؋6T8渇R6T8hh]N"o؃> }"6hh~N"oҸء;T8~6hhN"o؃> }sk6 6؋ۣutءNRPhhN"o끸=hhN"o3~?tk"_ڣ} ءw66w66w66hhN"owtw6hhN"ohhN"o)(~'th_h׊hhhhNhhNV_ڣ} ءhhN oFVuuw؋zxFV66vvhhNhhꞚohhꞚNW)t~Atfh_h׊hhNhhN6>hhj>_ڣ}%؃>uhhN"oءh_h׊hhhhNhhNV_ڣ} ء6<{u\66oڣ؋6N6<}u#؋6N6ء ؃>u#66hhNhhz~o 66hhN"o)u0؃>uhhNhhz~ohhN"o)-|=.,:VHV666/Wڣ}hhN"ou3ڣ)ː:[| ؃>:[ ~ :[؋6:[؋UUFNtv vF FUjhh0oUjhh0ovm WvtvPWv "WFvFFtKj!g%FUt$~ tF2P%W~ u j %WF:Fuv v oFvvo+FFF|;vv^v :u$vv v FFvP0o u N3jo6060jo6060joUuuwء;Vu;Ft_FV oFv W}vvhh _"o&vvhh5_"ow؋FVUt#~ t FP%W~ u j %WnWjdhhN_4gjjgF~}:[,~thhT_hhh0gt:[hhZ_hhh0gt:[hh`_hhh0gt :[ xhhf_hhh0guHhhp_hhh0gu0hhu_hhh0guhhz_hhh0gt :[ :[7~u0hh}_hhh0gt :[ :[džZwءڣ/:[؃>/}0wthh_"ohh_"o30w*uhh_"o30wu*w|shh_"o30UuUt_6UtQvvUuUtءUU!`RPhh`dPod҉FVj6/hwh*hhN,W }7F̌҉FȉVhhNhh"`vvȚo FPlo3/w6jw66W|j Wj6/hwh*hhN,W }7F̌҉FȉVhhNhh7`vvȚo FPlo35/w6jw66W}'hhN`"ohhNhhy`"o3.h"Wء/2N؋YY`bء/ڣ/؁&/؃>U|vvoڣ0Ŷ`0FVFXŶVtZŶ`TDۣ0060t0ŶV60:uŶ`D0 0V띸؁>/t ؁>/u ؃0ءUڣ00} 0؃>0~ ء0-ء0ڣ0dž\ء [;\~#\؋,Z;/u\ϸw(twt vvhh`"owtCء [;\`\؋(Z*ZRPhhNhh`"o ء [;\`\؋(Z*ZRPhhNhh`"o w؃>|&>vw66hh`"ohh a"o60hha"ohh8a"o;g}r؃>/u!WUtTj Wj6/hwh*hhN,W }'hhva"ohhNhha"o3+؃>/u h"Whh0ĵouءUZjohh0ĵot)؋6U$["[hha"oBhgh߿jojjjou=thghjoj oZhha"o؃>/ t؃>/t ؃>/u j Whha"o؃>/ t؃>/t ؃>/u j Whhb"odžR0džTŶRtZŶR7yWt?z}hhzŶR2PWoŶRڋ6zzz2Rhh#b"o-hh(b"o=u=u=uK=tӚ2g3)jojjjoۣ00u=thghjoء/ ؃>/udž\dž\<UuUt؋UUNP.؃>/uء|Y~Y ءWWNP6[6[~OŶ`t PN4gjjgڣ<[<[~jo6[뤸<[~c؁>0~ 0j 60hhAb<Po Ŷ`t <P4gjjgڣ<[, <[uڣU6Uhh0odžKbdždžLbdžUuUtءUU ءYYNP6[6[~_!WŶ`t PN4gjjgڣ<[<[t h,"W;gnW6[딸؃><[}Ujhh0oUt, Ut! hhMbhhh0gu0hhQbhhh0guhhUbhhh0gt:[MhhYbhhh0gt:['hh]bhhh0gt:[hhabhhh0gu0hhebhhh0guhhibhhh0gt:[hhmbhhh0gt:[ hhqbhhh0gt h0g`hhubhhh0gt h0g;hhybhhh0guhh}bhhh0gt :[Ut'؋6:[UUhhb"onW؁>0~ 0؃>Nu4wt3P60hhbPo 2wt3P60hhbPo ҉VX6[6[~UŶ`t XV4gjjgڣ<[<[th"WnW6[랸؃><[}Ujhh0oء:[3hhbPoGhhbPo1Ɔ*-|= .h!!!M7!!777҉VXŶVu6[6[~UŶ`t XV4gjjgڣ<[<[th"WnW6[랸؃><[}Ujhh0o/tnء:[9džbdžSdžcdžEUthhc"o(-|=.EaaSEESSSء:[XUtAcGc]UtMcTc8dž[cdž*-|= .ҳҳҳҳdž\cdž0]c0ء/0^c0ء:[*džgcdžFdžtcdž8džcdž*-|= .xxxӔӔxxӔӔӆa0c0džcdžA؃>:[t$؃>:[t؃>:[t ؃>:[ u0c0džcdžUthhc"o؃>:[tk؃>:[t_؃>:[ tS0c0؃>:[ udžcdž&؃>:[tdžcdž džddžUthhd"o@=ue=u]=uT=uL=u=u=u=uUu08d0wء(džD ;džD 3džD +džD#džD =t=et=mt=ot=stݸ؃>:[ t5wؠ2PDhhEdPoPhh^dPo0gd0Uthhwd"oQ0d0؃>:[ uddRPhhdPo҉VXŶVu6[6[~UŶ`t XV4gjjgڣ<[<[th"WnW6[랸؃><[}Ujhh0o؁&/johgh߿joۣ00jhh02Pg hh0ĵotOj2Phh0g jo6RYhhd4g6PY6NYagjoUuUtءUU ءNYPYNP6RYPN4gPNagjo6060joj2Phh0g !WxUuUtءUU Ŷ`DT NPPuNt-PNo~Ŷ`t PN4gŶ`DuDtPŶ`tto~:hgh߿joۣ00j oŶ`ttag=uJ=u = u =u=u= u =uc=uX=uM =uC =u9=u.=u# = u=ujo6060joh"Wء/IUtŶ`t hhd4gŶ`t hhd4gjjg =tŶ`Du DuŶ`tuŶ`tŶ`tt4ghgh߿joۣ00j oŶ`DuDtŶ`ttagh,"Wjo6060jonWvvUuUtءUU Ŷ`DTRPhh0o Ŷ`thh04ghgh߿joۣ0060o^ء/-jonWj Whhdag = t=t<[hhdhh0o<[tء/džZZc|j!gFFt~uF$ZZڈ0Z؊0Pg؃>/uQZ}Z؀0 uZ؀0 uZ؀0 uZ؀0 uwr؃>/uDZ؀0 uZ؀0 t Z؀0 uZ؀0 u'"Z؀0 tZ؀0 uZZƄ0Zu<ء/hhdhh0gthhdhh0guxhhehh0gu`hhehh0guHhhehh0gu0hh(ehh0guhh2ehh0gt <[;hh/uLdžDDc}}j!g%FDDڈ0D؊0PgD؀0 uD؀0 t D؀0 uD؀0 u|<[Ut=wt0jo'WDD~Dthhe"ohhehh0gt<[hhehh0gt"<[hhehh0ohhehh0guhhehh0gthhehh0ohhehh0gthhehh0ohhfhh0gthhfhh0oshh fhh0gthhfhh0oDhh%fhh0gthh(fhh0ohh6fhh0gthh9fhh0ohhGfhh0gthhJfhh0ohhdfhh0gthhgfhh0ohhfhh0gthhfhh0oZhhfhh0gthhfhh0o,hhfhh0gthhfhh0o<[hhfhh0gt!hhfhh0o<[Shhfhh0gt!hhfhh0o<[؃>/u`<[hhfhh0gt<[hhhf4ghhghh0ou <[Vhhghh0ot0hhghh0othhghh0ou<[?hh ghh0gt<[hhghh0guxhhghh0gu`hh$ghh0guHhh*ghh0gu0hh4ghh0guhhAghh0gt <[{hhHghh0gt <[#hhPghh0gt <[0UuwtdžV0džXŶVtŶV/uNhhghh0gt6<[w(uwuhhg"ohhghh0gu0hhghh0guhhghh0gt<[hhghh0gt<[hhghh0gthhghh0gthhghh0guxhhghh0gu`hhghh0guHhhhhh0gu0hh hhh0guhhhhh0gt <[hhhhh0gt <[;hhhhh0guhh hhh0gt <[hhh(hhh0gt <[#hh0hhh0gt <[hh/u <[N؃>/uUthhi"o$؃>/uUthhi"o؃>/u&Uthhj"o<[؃>/u <[-|=H.#>g %@[v4Nx؃><[t86=t~Utqhhj"o86=Ruhhj"o86=Luhh%j"o8F6=Cuhh*j"ohh6j"oء0B<[BB=/WDD~FDd~džDdhh0DYWDD~Uthh0%W'WDD}"Dt <[ jodC=u= u;= u=u=u=u= u=ujo^؃><[tUjhh0oh"Wjo؃>/t w6jw66W2gw(uwuhh9j"ojhh0o8[hghjoFVvoFhh0ĵot3voFuFtvvjonW3؃>/t ؃>/uhhKjagFF~?}vƄh0 F踇0Ft4j!gFF}/voFuFtvvjo$F%FFu뢸Ut FP%WF~>}v؊i0vڈh0Fݸ؊F0F2iؠ0bFt؀>0 t ؀>0 u؁/F;Ft؀>0 t ؀>0 u؁/F =0t=4tŸUt/t j %WhhOjhh0ouFhhTjhh0ouF؁&/hh\jhh0othh`jhh0ou 8[chhdjhh0othhhjhh0ou 8[&F= u-= u=Tt=tubvoFuFtvvjonWFFUu!gFF~Uthhlj"o}wtUthhj"o3s WFUt)~E6)؃u ء7ڣ0؋6)؃u ءV8ڣ00t!w66hhNhhk"o 0؋22FV!vP kgDDRPhh0oFvujjhh0hhkj~g6Nw66W}hhk"ojjjoFV o62uSvvjo0thhl"ojjhhDlhh1lj~g˸262t627yuո4P4uJ؋6222<-t oTot؋6222<-to멸62t(62227yt 262t627yuҚ o62uTouvvjo0thhEl"ojjhhilhh[lj~g3w tS/WF=~D~~Fhh2vYWF=~hh2j/W} w ˚nW 6rut9j6rWFjd6rW6rD4u D2u6r(u &u6r u uj6r WFj6r(&WFj6r0.WF6rDHP6rt4t2WFFFFF FF6ȋFD^F+Fd1ɚo6ȉD\6Df36ȉDd6rut[6rutEj6rWFj6rWF6Df6rut2j j 6roRPW6ȉDfA6rut6Df6Dfu 6Df6Dd 6rtu{6rut'j6rW6Dd6rut'j6rW6Ddjj j6rtPtNoRPW6ȉDj6rt0t.W6ȉD@j6r@>W6ȉDBj6rt(t&W6ȉDDj6rt`t^W6ȉDFj6rtltjW6ȉDH6ȋDH6ȉDJj6rtTtRW6ȉDLj6rtttrW6ȉDNjj 6roRPW6ȉDPjj 6roRPW6ȉDRjj 6roRPW6ȉDTjj 6roRPW6ȉDVjj 6rtHtFoRPW6ȉDXjj6r$"oRPW6ȉDZj"j2oFVFFFF6rutNhh.m6rot.hh0mh6rvv2oFVhh5mh6rvv2oFV6rdubtNhh8m6rdbot.hh:mh6rdbvv2oFVhh?mh6rtrvv2oFVhhEmh6rXVvv2oFV6rutNhhJm6rot.hhLmh6rvv2oFV6rut6rVmRPh6r,*vv2oFV6rut6rYmRPh 6r0.vv2oFV6rut6r\mRPh 6r86vv2oFV6rut6r_mRPh 6r<:vv2oFV6rut6rbmRPh 6r@>vv2oFV6rut6remRPh 6rDBvv2oFV6rut6rhmRPh6rHFvv2oFV6rut6rkmRPh6rLJvv2oFV6rut6rnmRPh6rPNvv2oFV6ru u 6rRPh6rTRvv2oFVhhtmhH6rvv2oFVhhwmhI6r`^vv2oFVhhzmhJ6rvv2oFVhh}mhK6r\Zvv2oFVhhmhL6r vv2oFVhhmhM6r  vv2oFVhhmhN6r(&vv2oFVhhmhO6r$"vv2oFVhhmhP6rxvvv2oFVhhmhQ6r|zvv2oFVhhmhR6rljvv2oFVhhmhS6rpnvv2oFVhhmhT6r~vv2oFVhhmhU6rvv2oFVhhmhV6rvv2oFVhhmh[6rhfvv2oFVhhmh\6rTRvv2oFVhhmh]6rXVvv2oFVhhmh^6r\Zvv2oFVhhmh_6r`^vv2oFVhhmh`6rdbvv2oFVvD FV˸qmU~ u~ t9vvvvov v FvPovFD F"FVvDŽ@6rD&D(#o3_Ŷ|Ŷx|xjju؋rrVXrrxz2Ŷ|U|xz;Xwr;VsŶxUxhhu|t|؋rr&VXrrZ\>~|oT|Z\;Xwr;VsŶZTZffuhhn oprhhn olnruptrpto6rDnultnlto6rD؋rrjVXrr&Z\ddu~|ov|Z\;Xwr;VsƒvtiŶZDnu u˸rtj6ȋ %Pj^g6Dt!hoh.|j6ro r6D(#o6Du 6D tjj+6ˋD6D P6ˋ6DP1o6ˊDP%oDDFU6rt6rr~PhT6rjo vDu&ءȋ;Vu;Ft6D(t96D(vDءȋ;Vu;Ftvv\%oءȋ;Vu;Fuj%o3Fv^w_]]w _  vv1ojRfoDD{ou76D|%6D|6t6tffogء˸6rD;F|8vw_Tvw_;Tu;t6rD;F}FFFF6rD;F|8vw_Tvw_;Tu;uNF;FtFHPvw_t4؋vw_t4Eo vw_Tvw_;Tu;t"vw_t4hQovw_Tvw_T56rDHPjFHPFHPLiogovv"7oF@F/vw_Du%u_ovw_Tvw_Du9u1vw_Tvw_T؋vw_t40ovw_t40oF6rD;F|FFFovFw_4vw_4;uFvw_4ڋvw_4;uFF6rD;F6rD-;F|F;F6rDHPj6rDHPjLiojRRoDD6ttthQoF7vFw_TvFw_;Tt;t_oFVvFw_4DFvDvFw_4vvT D FVvFw_4T D FVvvFFN~vFw_FFDvFw_Tvw_TF6rD;F~_o6rtw_TFFvw_TFVu ~uvw_T;Vu;FtdvDFvT D FVF=vv^3%utvvvv 5ovD FF;F|F6rD;F|3 ~u ~uvtFvT D FVvDD T FVnFV;Vrw;Fvv< tFFV;Vwr;Fwv< tF3ҋ^3+ѻ1ɚo@vDFvFFFV;Vwr;FvvFvuv{ːF@F6D|x6ȋtFw_TFVutNvD6;D}:6ȋD6r;D|6rD 6ȋDvD6ȋFD6ȋFD~}~}vw_Dut;؋vw_Tvw_;Tt;t_oFVvw_Duto؋vw_4DFvDvT D FVvw_4T D FVvvFFN~vw_FFDvw_TFVvv\Dv\ \  vD;F|݋Fvw_4D T 6ȉDT ːUhoh.|j6ro hoh.|j6rtxtvo hoh.|j6ro hoh.|j6rtu@6rD t1F;F|&~~>vvffo,SoFFFF v FFV;Vwr;Fvvvvvvvvv\`oUvvffo~ ~,6rutv tPoDDjJQojJQoDDv YoF3ҋ^ 3+ѻ1ɚo@Fvvffo~~J6rut1vtPoDDjjvvv v vv\`ojJQojJQoU6ru u6r6rouK6ȋthoh.|j6ro 6ȁ$ 6ȋ%=u.hoh.|j6ro 6ȁ$hoh.|j6r&6ȁ$hoh.|j6rt|tzo N}ܸ6rut6r6rothoh.|j6ro uU6rutE6ȋu2hoh.|j6ro 6ȁ$ 6rutU؃~~Mhoh.|vv6roRPo hoh.|j6ro N|U츇6ȋF%$ ː F~u ~u6rDFFF6DTFVvT;Vu;FuFNn~ދFFF6DTFVvT;Vu;FuFNn~ރ~46ȋT D vDTv6ȋFD FD 6r,u*t"goj6tffoF=jjffov\ohoh.|j6r,*o FF;F|ԋF6Dn6ȋDn6rD6r;D~6rD6r+D6ȉDn|6rDugo6rD@uD>tJhoh.|6rD6+DP6rt@t>o j\oDDj[Toˎ6ruD~t&6rut6Dt6ȋtFw_TFV6ȋD@FvD;F~v^w _ < t!v6tffojYoF6rDu6D$tgo6ȋDF6r;D|E6rDDuDBt.hoh.|6rD6+DP6rtDtB6rD u<6ȋDF6r(u&t46r uthoh.|j6r(&o 6rDDuDBt9j6rD+FPffohoh.|v6rtDtBo 4F%j6rD+FFPffo,SoFF;F|Ӹ6r(u&t66r ut hoh.|j6r o jvffo6r0u .u6ȋD6;DtgoFF~j6tffohoh.|j6r0.o 6Dn~6Ln6rD@uD>t(6rD thoh.|j6rt@t>o Nb6ru u؃~6rŴthoh.|6rD6+DP6tv6roRPo hoh.|j6r(&o hoh.|j6t6t6rt4t2oRPo hoh.|j6r o FF6rD4uD2t6rŴuThoh.|6rD6+DP6ro FHF~hoh.|6rD6+DP6ro Nhoh.|j6r0.o N~hoh.|j6t6t6rt4t2oRPo hoh.|j6r o 6ȋD6ȉD6ȋD6ȉDU~u{o{o6ȋ%=uQ6rut8؃~uhoh.|j6rvhoh.|vv6rR6rutM6ȋ%=t7~~1hoh.|vv6roRPo ˸6r u u6ȋ%=up~ghoh.|vvj 6r  oRPo F6D}6ȋ%=uN6rut5hoh.|6rD6+DP6ro 6DD6r;D|M6rDt<6rDH6;D6L6D6Dj .|oDD6ȋ%=u76ruthoh.|j6ro N}Q6rD6+D;FI6rD@uD>t~t6rDDuDBthoh.|v6rtDtB6r,u*t%6ȋD6;DugoFF6ruta؃~ 6rt~uMhoh.|6rD6+DP6tv6roRPo ˎ6rD4u D2u6rt~thoh.|j6r(&o hoh.|j6t6t6rt4t2oRPo hoh.|jj6t6rtPtNoRPo FFF;F|+hoh.|6rD6+DP6rt~o Fj6tffohoh.|j6r,*o 6DnN~6ȋDn6rD6r;D}6rD6r+D6ȉDnYhoh.|j6r,*o FF;F|hoh.|j6t6t6rt4t2oRPo hoh.|j6r o 6ȋD6ȉD6ȋD6ȉD6ȋT D FVu~t/vTD6ȉD T vDvFVjjoFVj6rtovUrurt,6rpt6rrlPhT6rjo<F6ȋD"FF3ҋ^ 3+ѻ1ɚo6r;D~Vj6rDHPffoF3ҋ^ 3+ѻ1ɚoPvvv v hhqhhz~oo~u~t"vT D FʉV̋FFʉFF̉F FFF FF F҉v3%utF~u~tvF3%utFv< u1F@@FFFvF< uvF< u v< uFv%ŶFFV;Vw s_;FwWFFڋFF؃~u~t8vT D FʉVvDF܋F FF FFFʉFF̉FqFFF~u/vvؚffojRfoDDPwov DF֋FFʉFދF̉FF FF FFFʉFF̉F҉FV9v3%FF֙%FvD3%FҸ6rD| F;Ft3Fи6rD|#v3%؋ʋFҙ;u;t3F΋FV;Vrw;FrF vFv;FuQ6ȋ%=t;~u5~u/6rD uBFFʋV;Vv/r;Fv%vvؚffo6rDt~uF֙%ut_vRfoDDF;FtU6rD|E{o6rDF6rDF6rDF6rDFڸ6rD|v< tF@@FFFF@@FFF4džFFFFvvvv暚woFڋF拆FFFFFڃFFFFV;ws;w6rD}R~uIjRfoDD{o8vv;uSF@@FFFF@@FFFvFvF;u#vFvF;uvv;uFFFFV;Vvr;Fvvv;uQFFFV;Vw>r;Fw7vv;u+6r u tFV;Vwr;FrnnF3ҋ^3+ѻ1ɚoFbU츇6ȋFD"U츇6ȋD;Fu6ȋD;Fu 6rDu16D$t!6rD}6rDugo6ȋ%=u:6rD u)hoh.|j6ro 6ȁ$6ȋD;F6ȋD;F}-6rDHPj6rDHPjLiogovv6t6tio6ȋFD6ȋFD6D$t,6ȋD"F6D"{o6ȋFD"U츇6ȋD6;Du6ȋD6;Du6r<u:tHhoh.|j6rDHPj6t6t6r<:o RP6rD4uD2t}hoh.|j6r(&o hoh.|j6t6t6rt4t2oRPo hoh.|j6r o 6ȋD6ȉD6ȋD6ȉDU6rD4uD2u6r<u:t6ȋFD6ȋFDF;F u F;F u6ru3ڣ>~ tF@;F u{6rD0uD.td6rDTuDRtP؃~~.6rD0uD.thoh.|j6rt0t.o hoh.|j6rtTtRUv jv jloFv jv vloFjv vqoFv jv juoFv jv vuoFjv v}toF6ȋDFFFF ;F}'F ;F}FFFF츇6ȋD@FAF ;F}FFFF~|jjv vuoF6ȋD@FFFF;FjF;FbF;FZhoh.|jv v 6rtPtNoRPo F ;FF ;F~dv jv vuo_F;FF;F~ȋF;F~hoh.|j6rt0t.o F ;F~ijjv vjv v}tov jv vYF ;F~v jv vuojv v}tojv vqojv v}tov jv jlohoh.|j6rtXtVo v jv juout6ȋ%=t3FF;F} 3ˋF;Ft~t6DH6ȋDJ6ȉDHFF6rD;F6rDHFF+FF=FFF;F}+F+FF6ȋDBnظ6ȋDHn)F+FF6ȋDBnظ6ȋDFn؉^F+F6lHF6rut6ȋDRFF6rDHuDFt6ȋDXFFF;FHF;F@F;F8~ t,hoh.|jv6rtHtFoRPo FSF;FFF;F>~ t2hoh.|jF+FP6roRPo F~ uF;F}F!FFv Fw_TFV6rDluDjtc~t<~u~tQ6ȋD$3ҋv^w _ 3Ɂ;u;t!hoh.|j6rtltjo 7~u~t!vD;F~v^w _ %Pj .|oFF;F} F;F}FFhoh.|j6r@>o FF;F|ԋF;F|FF;F}v Fw_TFV6rDluDjtf~t?~u~tT6ȋD$3ҋvv^w _ 3Ɂ;u;t!hoh.|j6rtltjo =~u~t'FFv;D}vv^w _ %Pj .|oFF"hoh.|j6rt`t^o FF;F|F;F~<5~ t,hoh.|jv6rtHtFoRPo FˋF;Fu6rD`u D^u6rD(u D&uFF=}FF+FF=FFF;F}0F+FF6ȋDDnظ6ȋDHn.3TF+FF6ȋDDnظ6ȋDFn؉^F+F6lFFF6rut6ȋDPFF6rDHuDFt6ȋDXFFF;F F;FdF;F>~ t2hoh.|jF+FP6roRPo FS~ tP6rD(uD&tFZFF"hoh.|j6rt`t^o NF;F֋Fhoh.|j6rt(t&o FF;F|֋F;F}1FF;F}hoh.|j6rtltjo FF"hoh.|j6rt`t^o FF;F|cF;F~ 3ˋF;Ft6rDtuDrtF+F6lNFF6rut6ȋDTFF6r$u"t6ȋDZFFF;FBF;F:~ t.hoh.|jv6r$"oRPo FF;F>~ t2hoh.|jF+FP6roRPo F~ t2FF"hoh.|j6rtttro NF;F֋FF;F} 3ˋF;Ft6rDTuDRt;~ t>u6rtR< tF+F6lLFF6rut6ȋDVFF6r$u"t6ȋDZFFF;FBF;F:~ t.hoh.|jv6r$"oRPo FF;F>~ t2hoh.|jF+FP6roRPo F~ t2FF"hoh.|j6rtTtRo FF;F|֋Fs{o{oFFFV;V wr;F wvvF:t܋F6DNN6L6rDH6;D6rDuhoh.|vvvP6r  oRPo FHFFFv:DtFvFF6ȋ%=uN6rut5hoh.|6rD6+DP6ro 6rDtN6rDtD~_u>6ȋ%=t(j .|oDDhoh.|j6rt`t^o 6DD6r;D|W6rDtF6rDH6;D6L˸6D6D6rDt ~~uj`v.|oDD6ȋ%=u76ruthoh.|j6ro 6rDt#6Duj .|oDDj .|oFV;V v7r;F v-6r u u6ȋ%=uF@FFFvvF:tvvF:tvvF:tvvF:tyFV;V vks;F v^U츇6ȋD$6;D"tThoh.|6t"|o6ȋD"6ȉD$6rD|6rD6DːU츇6ȋ%6ȋ;trhoh.|j6ȋ%=u6r6rRPo 6ȋ%6%$ U츇˸utM6ut96Ŵ }6,F%6Ŵ\D\8z}hhzF%2PWoˋF%6zzz2wءF~u6rtt6r4u2tsv vjF%PF%@PF% PF%PF%PF%PF%PF%PF%P6r42oRPo FFwء%~V~;6rut0v vj6rTv vj6ru96rut v vj6ro 6ruuw3FFt.u&v vj6ro NFu3wt&v vj6ro fF@t3w@u&v vj6ro N@F t3w u&v vj6ro N FtIwu<6rut#؁Nv vj6ro FtIwu<6rut#؁Nv vj6ro FtIwu<6rut#؁Nv vj6ro FtIwu<6rut#؁Nv vj6ro FtIwu<6rut#؁Nv vj6ro Fu3wt&v vj6ro fFtIwu<6rut#؁Nv vj6ro Ftwuv vj6ro f6rut0v vj6rTv vj6ru96rut v vj6ro 6ruuFFt5F;Ft-Fu&v vj6ro Nw؋F`FFFFFF>FFF~u~uhh rhh]r? .;~ }~d|mF=t$=t= t~t6rDRTTF6rDjTlFV~tK~u~t?6rDH;F~-6rDtuDrt؃F6rTtDrFV~u~t06rDNTP;Vu;Fuvvhh?oNFvFvNv6D3҉FVNvvov6D3҉FVNvuvvFFF F vFF-1}=~.FvF FvF 6DFvFFvFFvFFvFFvFFvFFvFhh7r񄄓ńԄ~1u3Fv6\va6\N!va6DFv6DFnvFv6DFvF<'uIhhGr;FFv<-uF v<+t/F)v6DFNv6DFNFF$v6DFNv6DFNF+Fv6DFNv6DFNFnv6DFNv6DFNF~v6DFNv6DFNF~Fv6T/v6DFNv6DFNF#F=v6DFNv6DFNF Fv6DFNv6DFNF3Fv6DFNv6DFNFFv6DFNv6DFNF;F~0v6DFNv6DFNF;F|3]v6Du3v6Dv6DvN6Dtjej;vvAoFVՇFFFOʆFF9FFdFFxFFFFFFFKvFFFFFFFFFFFFFFFFAFFFFFFFFFFFFF FFFF!FdFVFFFF_FF#FFFFFFFvFFtS~%u@v6DFv<0uFFvFF-!|=]hhsrFvFhh?vvo>˃~3u vFu1F~t 6rDuvv voFVvFP^ DDFV6r%F=~~|ˋv؋rFF6rut6rŴFFF~F v^DDN~3Uw=uojoPoFvF7yuV FvFv7yuF=+t=-uFFvFv7yu33FV˸0+FFV#FV 1ɚ\oFV0+FFVFvF7yuÃ~uFV؃띐Uvvj sWːUv vvjsWUhhr~u~tFVRPo˸&?UvvoRPAoovT+rrFVFP{oFVvDFFwF/v| Jt v| Ku0vt J؋sFvt J؋sFvvv3oFvvv3oFrtTF;FF;FuDv||;F;F|F;Fu+v|}"FVFP{oFVvDFVU~ :|vD tmn-mF vDV +T ¼™F + vTQ~oFVvTQoFV~|~sFQVn^FV<1ɚ~oڣJ?FV<1ɚoF<؉L?FFN?FVp1ɚ~oڣV?~|M~rEFFFtmn;VZ|;FwSFtmn)FVFFF FHtmnFVN~|؃~rҸ؋FT?FFX?Ftmn=nu sFv拄s)FFv؋s;F~sF@ڣP?FR?Z?J? F0?FF,sFvFvFuvkD FsFFF0?FvvFFvvFFvvFFFFFFFvk\sFFvvFFvvFFvvFFnv4vvʒoFVnvdPvvʒoFVnvdPvvʒoFVnvdPvvʒoFVv| d|vD2vD0FvD dPvvʒoFV0?UF~ |3F 0vFF 0vFFVv hhs oFVuu vuF؋rrFVvt vF vFNuv<-u3FtFFk^ v؃0^Fv<0|v<9~ۃ~tF؉FF<<1ɚ\oۣrrvt3ڣrt:؋ssFVFvt vF vFNuːUvj)sW~ ~~ 3FF H3v V +ЋˋF n Fvvvұo=tvLvv;FvFvFvvttvvo FVFFFFFFv)FvDvD ؋{v+D}3v;}vvPoF)Ft;F *~ uwUjsWːFfFPoDDFVutvjvvoFVUvv:oUv v vvj sWːUv vvjsWFsFwء;vt}w؋6؋ssFVvvoF=t%vvvj(ojhhsj(ovvoPvvj(ojhhsj(oːFPo}v sWːoFVutavvD FvD vDD3v\DvD ؉{DŽ{v=at=rt =wt 33vL jjjv*ovL v|+uvd vL FVUj*sW^ۋvT3F ҉FVؠz uz t.zhhzvvvv o Fz tˋFF҉FVvD uvD t-vL vvvvv v o FvD tˋFFؠz$<u2zuzt"zz;zuC;zu=zu5zDu.hhzot3hhzo=u&˸ؠz؋{{FV؋zzFVV+ЉV~vjvvvvZo FVut F+FFF)zFzz؋{+zz}3z;}hhzPoFF~u~t26zD zDthhzo=uFFFSQW~v ^N~HFt ;sN)Vʋt ;sN)Vʬ:tFtj oPo1 nj…u_Y[UvvojjjvD P*ovvTDDTvd vD tvd ːF ҉FVvvvvhhzʦoF҉FVvvv v vvʦoF҉FVFFVFVFVvvoFFvvv v FPʦo džv F 2䉆uC7yt;%uv F 2䉆=%uNv }vvұov\D\2䉆;tvvlo=u*udžv 2䉆F dždžk -0v 2䉆F 7yu҃udž=lthuv 2䉆F u<[u%Pv v xoF V uu7yt džl ctZ[tSv }vvұov\D\2䉆7yuvvlo=uctst[u'FPvvPuo#FPvvot~u~t tt˸v }vvұov\D\2䉆7yuvvlo=tJ^F҉FVFFFFFFFF=dt(=et =ft=gt=ot=ut=xu-FFF Fv }vvұo3v\D\2F=+t=-u,FN Bvvұov\D\2FN }$v7yu~usv7ytfv7yt0v7yt7WV+ЉV;F|~t'~u!F^N\o؋ʋFʉ^NF~u~.u FFtk~et~Euw~tqFFugFvFv }vvұov\D\2F7yu ~+t~-uFvFv |~u~u~tUvFPNo^~t F^~ luv4|v6kv4tFX~t ~u~tFV؃FV~ luv4tFVT~ hFv4tvvvlo=u vDF ~tv4DT33҉FVFV~cu ~ uF v }vvұov\D\2F=t?~suv7yu*~[uvv ^u~tFvFN ~t~ ~"vvvlo=u vDFV;Vu ;Fu3˃~t ~ctvFv<^uFFh~u3Pv v ov2F=]t~-uqFvv ^ N~u33˃~-uAv2F=]t2vD2F;F}"F+F@PvFF v PoFFvv ^ vF2F=]uFVFFFvF7yuF=+t=-uFFFFFFFFFF~.u~uP~0t>F~u~u  xF^~|~v FNF^~Et~eu~FFv= t =+t=-uFFvF7ytB~} kF F-0FFvF7yu҃~tF)FFF~uFwF~vЎ6v(xu;~0xعv \F~w r~xrFwFFF}F؉F~8xЎع~~ FFFt vN^~~ukFP~}FvF6o ^~tFRFLN~ !|~sFV 1ɚ\oFVA~ 7|~s.FV 1ɚ\oFVFV 1ɚ\oFVFN~N~ .|~s%FV 1ɚ\oFVF-0FVN~ D|~s;FV 1ɚ\oFVFV 1ɚ\oFVF-0FVFvFF7yt~.tFFt vDuDuvvJovD uvD uvL vD Dt?FzFvD @tvvoF ء{{;Vrw;FwvTDDTvD tvD ؋{v+DPvttD Pjovv |v\D\2vvTDFV>uFV >؋{{FV N{NtNmNfN@F@tF v DF=}FF?F v DF=}-F؉FvFDuN F-0< NvFF- }C=X~;.AFtF v DT F v DVXz҉FVFVXF|Vs=džjxdžldž^Xu VuVX؃VX.FtdžjxdžlFtdžjydžldž^V:X<=~ | : v <t :t F@t < FtF v DT F v D3҉VXz҉FVFVVX%uu\VP oNvCdž@džB dž@džBFtF v DT F v D3҉VX~XuyyFHz҉FVFVV:X<=t :t F@t9 F扆ZN' F@uFNЎF v 󥍆JPLPF@=}F@PN׎ǃ6oFVL F@uFNЎF v 󥍆JPLP~<}F<PN׎ǃ6oFV <+LFꃾJt&F;L}v<0tdžj0ydžl0_Ftdžj2ydžldž^Fulo҉FVL<džD<~vtD}DvFvF<Fu~~ v.F~<}Fdžj4ydžlv<;<| ><F F v Doo҉FV@FV F v TDFVF@uvvoFFF,F:F<Ŷ::tN}:HF^ZDF;D DFFFF t,FuNF+DF F+DFF쉆DFtF+D< FPvvjhhxto<<ً<FV8:;Vr&w;FvFPvv~c>FV:<;Vr&w;FvFPvv>vvto&>vvvvo :FF>FV:<;Vr&w;FvFPvv>vvto&>vvvvo :F:< 1ɚo:< 1ɚ\o؋ʋ>+0Nv<|: w:<0NvF@uF+FV+Љ<<@#:#<FHNv:<؁B:<u:uF@t$F+FV+Љ<~D؋BD@DۣHDJDF3һFF ;Fs؋>DDvTvTءHDJD;Vu;Fu FHDFJDvD4vF؋T%utFFV;VvPr;FvFFFV;Vs2w%FFڣDD;Vw2r;Fs+6DDDvT%TvT;BDu;@Du؋FHDFJDFFFFvDT%utvv:ovD3ҋ^3+ѻ1ɚoFv oDDFVu ~uFV;Vu;FuF 3һF;FsFFFPvvvvo FV;Vw[r;FsTFFV;VrCw;Fr(resend)Too many retries.(resend)(resend)%c-xx-%02d-%c-%02d-%02d-End of transaction files total file characters communication line in communication line out elapsed time (seconds) effective data rate efficiency (percent) end of file file characters communication line in communication line out W wwwwwwwwwwwwwwww ww%ld%ld%dsizetypedatecreatoraccountareapasswordblocksizeaccessencodingdispositionprotectionprotectionoriginformatsys-dependentsizeunknownrefused as mode: binary mode: textFailure to openauthorization failurecould not be openedauthorization failureFailure to openFailure to closeDiscardedIncompleteww444444444444444444444444444444444444244444444444444444444444444444444444444434444444444444444444444444444444444444444444444 4444444444444444444 444444444444444444434444444444444444444444444444444444444444444%442!44444444444444444"444444444444444444443444444444444444444444444444444444444444444#44$244444444444444444444'4444444444444444443444444444444444444444444444444444444444444444&244444444444444444444(444444444444444444344444444444444444444444444444444444444444444,424+4444444444*444444)44444444444444444443444444444444444444444444444444444444444444444424444444444444444444-44444444444444444443444444444444444444444444444444444444444444444424444444444444444444.44444444444444444443444444444444444444444444444444444444444444444424444444444444444444/444444444444444444434444444444444444444444444444444444444444444444244444444444444444440444444444444444444434444444444444444444444444444444444444444444444244444444444444444441444444444444444444434444444444  44444444444444444444444444444444444424444444444444 44444 4444444444444444444344444444444444444444444444444444444444444444442!444444444444 4444" 444444444444444444434444444444Wart Version 2A(009) 14 Jan 92C-Kermit Protocol Module 5A(055), 4 Jun 93User cancelledSEND disabledGET disabledBadly formed server commandREMOTE HOST disabledCan't do system commandQUIT disabledDid you say RECEIVE instead of GET?Unimplemented server functionREMOTE CD disabledCan't change directoryREMOTE DIRECTORY disabledAccess deniedCan't list directoryREMOTE DELETE disabledAccess deniedCan't remove fileFINISH disabledBYE disabledCan't send helpREMOTE SET disabledUnknown REMOTE SET parameterREMOTE TYPE disabledAccess deniedCan't type fileREMOTE SPACE disabledAccess deniedCan't check spaceREMOTE WHO disabledCan't do who commandQUIT disabledUnimplemented REMOTE commandCan't transform filenameCan't open windowCan't open windowNfile collision settingXError writing dataCan't open fileXZError writing dataCan't create fileCan't print fileCan't mail fileCan't delete temp fileCan't close fileCan't execute commandCan't open file stored asCan't send attributesCan't open windowDCan't open windowDCan't open fileProtocol errorUnexpected packet typeSorry, you must 'set speed' firstCan't open lineCan't condition lineKERMIT READY TO SERVE...Entering server mode on Type Ctrl-C to quit.Return to your local Kermit and give a SEND command.KERMIT READY TO RECEIVE...Return to your local Kermit and give a RECEIVE command.KERMIT READY TO SEND...Return to your local Kermit and give a SERVER command.KERMIT READY TO GET...KERMIT READY TO SEND SERVER COMMAND...C-Kermit server done wN1 wCommand package 5A(053), 21 Nov 92Command? %scmnum: illegal radix - %d Output file?Wildcards not allowed - %s /dev/tty?Write permission denied - %s ?malloc error 73, cmifi ?No files match - %s ?Too many files match - %s ?Read permission denied - %s ?File not readable - %s ?File not found - %s %s ?No files match - %s ?Too many files match - %s %s%s Input file specification %s?No files match - %s ?Too many files match - %s , one of the following: %s%s Directory name %s %s%s%s Please complete this field %s %s%s%s Text string %s %s%s?Unexpected return code from gtword() - %d ?Ambiguous - %s ?No keywords match - %s %s ?No keywords match - %s %s No keywords match One of the following: %s, one of the following: %s or the token '%c' or one of the tokens '%s' %s%s %d - Unexpected return code from gtword ?Not confirmed - %s ?Not confirmed - %s Type a carriage return to confirm the command %s%s %s %s?Command too long, maximum length: %d.  .w:.w.w.w.w /wQ/w/w/w 0wJ0w0w0w0w1wN1wu1w1w1w32wz2w2w2w 3wQ3wx3w3w4w34wV4w|4w4w4w>5w~5w5w6w6w\6w6w6w6w7wL7w7w7w7w 8wS8wo8w8w8w8w9wi9w9w9w9w:wX:w:w:w:w:w0;wL;wc;wy;w;w;w;w;w5w.>wa>w>w>w>w>w)?wW?wm?w?w?w @w/@w=@wY@w@w@w(AwiAwAwAwBw"BwTBwUBwBwBwBwBwBwBwCw CwCwBCwCCwhDwEwIEwlEwEwEwFFwFwFwFwFw&Gw`GwGwGwGwAHwHwHwIw`IwIwIw4JwzJwJwJwKwKw&KwmKwKwKwLwLw1Mw>Nw OwLOwOwOwOwOwPwRPwPwPwQwUQwQwQwRw`RwkRwlRwRwRwSw`SwSwSwSwSwJTwTwTw)UwqUwUwUwCVwaVwbVwVwVwWwXWwWwWwWwWw0XwJXwXwXwXw?Yw_YwYwYwZwMZwZwZw[wI[wg[w[w[w[w&\wH\w\w\w]w2]w|]w]w^w^w`^wk^wl^w^w^w_wY_w_w_w_w`w`wN`w`w`waw_awawawbwAbwbwbwbw.cwccwcwcwdwXdwbdwdwdwdwBewewewfwKfwfwfwfwgwjgwgwgwgwhwdhwhwhw/iw0iwLiwiwiwiw)jwrjwjwjwjwkwXkwkwkwkwkwElwlwlwlwmwTmwmwmw(nwrnwnwnw$owfowowowpw]pwzpwpwpwpwpw/qwzqwqwqwDrwErwrwrw!swQswRswzswswtwtwtw2tw~twtwtwuw,uw-uwOuwnuwuwuw2vwkvwlvwvwvwvwBww{ww|wwwwww/xwxxwxwyw.yw\ywjywywywwwթw"wHwIwkww֪wwAwwЫwѫwwwtwwǻwֻww%w&w9w~wüw wSwwʽww\wwwwwwww wVw}w [cmdfile] [-x arg [-x arg]...[-yyy]..] [ = text ] ] -x is an option requiring an argument, -y an option with no argument. = means ignore following words, but place in array \&@[]. actions: -s files send files -r receive files -s - send files from stdin -k receive files to stdout -x enter server mode -f finish remote server -g files get remote files from server (quote wildcards) -a name alternate file name, used with -s, -r, -g -c connect (before file transfer), used with -l and -b -n connect (after file transfer), used with -l and -b settings: -l line communication line device -q quiet during file transfer -i binary file transfer -b bps line speed, e.g. 2400 -t half duplex, xon handshake -p x parity, x = e,o,m,s, or n -y name alternate init file name -w write over files -e n receive packet length -v n window size -m name modem type -z force foreground If no action command is included, or -S is, enter interactive dialog. Usage: Trustees of Columbia University in the City of New York. Type INTRO for an introduction to C-Kermit, press ? for a list of commands.Type HELP followed by a command name for help about a specific command.Type NEWS for news about new features.While typing commands, you may use the following special characters: DEL, RUBOUT, BACKSPACE, CTRL-H: Delete the most recent character typed. CTRL-W: Delete the most recent word typed. CTRL-U: Delete the current line. CTRL-R: Redisplay the current line. ? (question mark) Display a menu for the current command field. ESC (or TAB) Attempt to complete the current field. \ (backslash) include the following character literally or introduce a backslash code, variable, or function.Command words other than filenames can be abbreviated in most contexts.From system level, type "kermit -h" for help about command-line options. DOCUMENTATION: "Using C-Kermit" by Frank da Cruz and Christine M. Gianone,Digital Press. DP ISBN: 1-55558-108-0; Prentice-Hall ISBN: 0-13-037490-3.DECdirect: +1-800-344-4825, Order Number EY-J896E-DP, US $34.95.New features since "Using C-Kermit" was published: . Hebrew character-set translation; commands: SET { TRANSFER, TERMINAL, FILE } CHARACTER-SET - { HEBREW-ISO, HEBREW-7, CP862 } SHOW CHARACTER-SETS . A way to send control characters "bare" in Kermit packets; commands: SET CONTROL-CHARACTER { PREFIXED, UNPREFIXED } { ..., ALL } SHOW CONTROL-PREFIXING . A way to change the Control and Repeat prefixes; commands: SET { SEND, RECEIVE } CONTROL-PREFIX SET REPEAT PREFIX SET REPEAT COUNTS { ON, OFF } . A way to change the packet-mode keyboard-breakout mechanism; commands: SET TRANSFER CANCELLATION { OFF, ON [ [ ] ] } SHOW PROTOCOL . A new string function, \freplace(s1,s2,s3). . A new command, SET OUTPUT PACING . . A new command, APC, for sending commands to MS-DOS Kermit. . Bug fixes, support for more systems. Type the appropriate HELP commands for more information,consult the CKCKER.UPD (C-Kermit Update) file for complete details.Welcome to C-Kermit communications software for: . Error-free file transfer . Terminal connection . Script programming . International character set conversion Supporting: . Serial connections, direct or dialed. . Automatic modem dialing . UNIX, VAX/VMS, OS/2, AOS/VS, OS-9, Commodore Amiga, Atari ST. Basic C-Kermit commands: EXIT exit from C-Kermit HELP request help about a command TAKE execute commands from a file Commands for file transfer: SEND send files RECEIVE receive files SERVER be a file transfer server Essential settings: SET PARITY communications parity SET FLOW communications flow control, such as XON/XOFF SET FILE file settings, for example TYPE TEXT or TYPE BINARY To make a direct serial connection: SET LINE select serial communication device SET SPEED select communication speed CONNECT begin terminal connection To dial out with a modem: SET MODEM select modem type SET LINE select serial communication device SET SPEED select communication speed DIAL dial CONNECT begin terminal connection To return from a terminal connection to the C-Kermit prompt: Type your escape character followed by the letter C. To display your escape character: SHOW ESCAPE To display other settings: SHOW COMMUNICATIONS, SHOW TERMINAL, SHOW FILE, SHOW PROTOCOL, etc. For further information about a particular command, type HELP xxx,where xxx is the name of the command. For documentation, news of newreleases, and information about other Kermit software, contact: Kermit Distribution E-mail: Columbia University kermit@columbia.edu (Internet) 612 West 115th Street KERMIT@CUVMA (BITNET/EARN/CREN) New York, NY 10025 USA Phone: +1 212 854-3703 Fax: +1 212 662-6442Syntax: BYE Shut down and log out a remote Kermit serverSyntax: CLOSE nameExample: CLOSE SESSION Close one of the following logs or files: SESSION TRANSACTION PACKET READ WRITEType HELP LOG and HELP OPEN for further info.Syntax: CONNECT (or C) Connect to a remote computer via the tty device given in the most recent SET LINE command, or the network host named in the most recent SET HOST command. Type the escape character followed by C to get back, or followed by ? for a list of CONNECT-mode escape commands.Syntax: GET filespec Tell the remote Kermit server to send the named file or files. If the filespec is omitted, then you are prompted for the remote and local filenames separately.Syntax: LOG (or L) name [ { NEW, APPEND } ]Record information in a log file: PACKETS Kermit packets, to help with protocol problems (packet.log)SESSION Terminal session, during CONNECT command (session.log)TRANSACTIONS Names and statistics about files transferred (transact.log) If you include the APPEND keyword after the filename, the existing log file,if any, is appended to; otherwise a new file is created.Syntax: SCRIPT text Login to a remote system using the text provided. The login scriptis intended to operate similarly to uucp "L.sys" entries.A login script is a sequence of the form: expect send [expect send] . . . where 'expect' is a prompt or message to be issued by the remote site, and'send' is the names, numbers, etc, to return. The send may also be thekeyword EOT, to send control-d, or BREAK (or \\b), to send a break signal.Letters in send may be prefixed by ~ to send special characters. These are:~b backspace, ~s space, ~q '?', ~n linefeed, ~r return, ~c don'tappend a return, and ~o[o[o]] for octal of a character. As with someuucp systems, sent strings are followed by ~r unless they end with ~c. Only the last 7 characters in each expect are matched. A null expect,e.g. ~0 or two adjacent dashes, causes a short delay. If you expectthat a sequence might not arrive, as with uucp, conditional sequencesmay be expressed in the form: -send-expect[-send-expect[...]] where dashed sequences are followed as long as previous expects fail.Syntax: RECEIVE (or R) [filespec] Wait for a file to arrive from the other Kermit, which must be given aSEND command. If the optional filespec is given, the (first) incomingfile will be stored under that name, otherwise it will be stored underthe name it arrives with.Syntax: SEND (or S) filespec [name] Send the file or files specified by filespec. filespec may contain wildcard characters '*' or '?'. If no wildcards, then 'name' may be used to specify the name 'filespec' is sent under; if 'name' is omitted, the file is sent under its own name.Syntax: MSEND filespec [ filespec [ ... ] ] Send the files specified by the filespecs. One or more filespecs may be listed, separated by spaces. Any or all filespecs may contain wildcards and they may be in different directories. An alternate name cannot be given.Syntax: SERVER Enter server mode on the currently selected line. All further commands will be taken in packet form from the other Kermit program. Use FINISH or BYE to get C-Kermit out of server mode.The SET command is used to establish various communication or fileparameters. The SHOW command can be used to display the values ofSET parameters. Help is available for each individual parameter;type HELP SET ? to see what's available.Syntax: SET KEY k text Map the key k to send 'text' when pressed during CONNECT mode.K can be expressed as decimal number or backslash code, 'text'can also contain any backslash code. If 'text' has the length 1it is treated specially. In some environments (OS/2, for example)that single character may be wider than 8 bits, if specified inbackslash notation. In this case, a scan code mapping takes place,i.e. key k takes over the function of the key whose scan code isassigned to k. This may even be a controlling key for the CONNECTmode. If 'text' is empty, the default key binding is restored forthe key k.Syntax: SET BLOCK-CHECK type Type of packet block check to be used for error detection, 1, 2, 3, orBLANK-FREE-2. Type 1 is standard, and catches most errors. Types 2 and 3specify more rigorous checking at the cost of higher overhead. TheBLANK-FREE-2 type is the same as Type 2, but is guaranteed to contain noblanks.Syntax: SET CONTROL-CHARACTER { PREFIXED, UNPREFIXED } { ..., ALL } is the numeric ASCII code for a control character 1-31, 127-159, 255.The word "ALL" means the command applies to all characters in this range. PREFIXED means the given control character must be converted to a printable character and prefixed, the default for all control characters. UNPREFIXED means you think it is safe to send the given control character as-is, without a prefix. USE THIS OPTION AT YOUR OWN RISK! SHOW CONTROL to see current settings. SET CONTROL PREFIXED ALL isrecommended for safety. You can include multiple values in onecommand, separated by spaces.SET DIAL DIAL-COMMAND [ text ]The 'text' replaces C-Kermit's built-in modem dialing command. It mustinclude '%s' (percent s) as a place-holder for the telephone numbersgiven in your DIAL commands. If the 'text' is omitted, C-Kermit uses itsbuilt-in modem-specific dialing command. SET DIAL DIRECTORY filenameName of dialing directory file. Type HELP DIAL for further info. SET DIAL DISPLAY {ON, OFF}Whether to display dialing progress on the screen. SET DIAL HANGUP {ON, OFF}Whether the DIAL command should hang up the phone before dialing. SET DIAL INIT-STRING [ text ]The 'text' is a replacement for C-Kermit's built-in initialization commandfor the modem. If 'text' omitted, use built-in initialization command. SET DIAL KERMIT-SPOOF {ON, OFF}If the selected modem type supports the Kermit protocol directly,use this command to turn its Kermit protocol function on or off. SET DIAL MODEM-HANGUP {ON, OFF}Governs how the HANGUP, H, and similar operations work when you havea dialed connection (in local mode, and a specific modem type is set).ON means to use modem commands to hang up the phone, e.g. ATH0.OFF means to hang up by attempting to turn off the DTR signal.ON is not necessarily supported for all modem types. SET DIAL MNP-ENABLE {ON, OFF}Enable or disable MNP negotiation by the modem. SET DIAL PREFIX [ text ]Establish a prefix to be applied to the phone numbers given in the DIALcommand or read from the dialing directory. SET DIAL SPEED-MATCHING {ON, OFF}ON (the default) means that C-Kermit changes its serial interface speed toagree with the speed reported by the modem's CONNECT message, if any. OFFmeans that C-Kermit should not change its interface speed. SET DIAL TIMEOUT numberHow many seconds to wait for a dialed call to complete. Use this commandto override the DIAL command's automatic timeout calculation. A valueof 0 turns off this feature and returns to Kermit's automatic dialtimeout calculation. Also see DIAL and SET MODEM. Use SHOW DIAL to display dial-relatedsettings. Syntax: SET FLOW value Type of flow control to use during file transfer and CONNECT mode.Choices: KEEP (don't change device's current setting), XON/XOFF (softwareflow control, the default), NONE (no flow control at all), and possiblyothers including RTS/CTS (hardware) depending on the capabilities of yourcomputer and operating system. Type SET FLOW ? for a list.Syntax: SET FILE parameter valueParameters: TYPE: How file contents are to be treated during file transfer.TYPE is normally TEXT, with conversion of record format and character set.BINARY means to do no conversion. Use BINARY for executable programs orbinary data. Example: SET FILE TYPE BINARY. BYTESIZE { 7, 8 }: normally 8. If 7, truncate the 8th bit of all file bytes. INCOMPLETE - what to do with an incompletely received file: DISCARD(default), or KEEP. NAMES are normally CONVERTED to 'common form' during transmission; LITERALmeans use filenames literally (useful between like systems). COLLISION tells what to do when a file arrives that has the same name asan existing file. The options are: BACKUP (default) - Rename the old file to a new, unique name and store the incoming file under the name it was sent with. OVERWRITE - Overwrite (replace) the existing file. APPEND - Append the incoming file to the end of the existing file. DISCARD - Refuse and/or discard the incoming file. RENAME - Give the incoming file a unique name. UPDATE - Accept the incoming file only if it is newer than the existing file.Example: SET FILE COLLISION UPDATE SET FILE DISPLAY selects the format of the file transfer display forlocal-mode file transfer. The choices are: SERIAL (the default). One dot is printed for every K bytes transferred. This format works on any kind of terminal, even a hardcopy. CRT. Numbers are continuously updated on a single screen line. This format can be used on any video display terminal. FULLSCREEN. A fully formatted 24x80 screen showing lots of information. This requires a video display terminal whose control sequences are understood by Kermit. NONE. No file transfer display at all. WARNING. SET FILE WARNING is superseded by the newer command, SET FILECOLLISION. SET FILE WARNING ON is equivalent to SET FILE COLLISION RENAMEand SET FILE WARNING OFF is equivalent to SET FILE COLLISION OVERWRITE. Syntax: SET HANDSHAKE value Character to use for half duplex line turnaround handshake during filetransfer. C-Kermit waits for this character from the other computer beforesending its next packet. Default is NONE, others are XON, LF, BELL, ESC,etc. SET HANDSHAKE CODE lets you specify the numeric ASCII value of thehandshake character. Type SET HANDSH ? for a list.SET SERVER DISPLAY {ON,OFF}Tell whether local-mode C-Kermit during server operation should put afile transfer display on the screen. Default is OFF. SET SERVER TIMEOUT nServer command wait timeout interval, how often the C-Kermit server issuesa NAK while waiting for a command packet. Specify 0 for no NAKs at all.Default is 0.The REMOTE command is used to send file management instructions to aremote Kermit server. There should already be a Kermit running in servermode on the other end of the currently selected line. Type REMOTE ? tosee a list of available remote commands. Type HELP REMOTE x to getfurther information about a particular remote command 'x'.Syntax: IF [NOT] condition command If the condition is (is not) true, do the command. Only one command maybe given, and it must appear on the same line as the IF. Conditions are: SUCCESS - the previous command succeeded FAILURE - the previous command failed BACKGROUND - C-Kermit is running in the background FOREGROUND - C-Kermit is running in the foreground DEFINED variablename or macroname - The named variable or macro is defined NUMERIC variable or constant - The variable or constant is numeric EXIST filename - The named file exists COUNT - subtract one from COUNT, execute the command if the result is greater than zero (see SET COUNT) EQUAL s1 s2 - s1 and s2 (character strings or variables) are equal LLT s1 s2 - s1 is lexically (alphabetically) less than s2 LGT s1 s1 - s1 is lexically (alphabetically) greater than s2 = n1 n1 - n1 and n2 (numbers or variables containing numbers) are equal < n1 n2 - n1 is arithmetically less than n2 > n1 n2 - n1 is arithmetically greater than n2 The IF command may be followed on the next line by an ELSE command. Example: IF < \%x 10 ECHO It's less ELSE echo It's not less See also XIF.Syntax: XIF condition { commandlist } [ ELSE { commandlist } ] Extended IF command. The conditions are the same as for IF (type HELP IF)but multiple comma-separated commands may be grouped within braces in boththe IF and ELSE parts. The ELSE part, if any, must be on the same line asthe XIF (or use dash for line continuation). Example: XIF equal \%a YES { echo OK, goto begin } ELSE { echo Not OK, stop }Syntax: FOR variablename initial-value final-value increment { commandlist } FOR loop. Execute the comma-separated commands in the commandlist thenumber of times given by the initial value, final value and increment.Example: FOR \%i 10 1 -1 { pause 1, echo \%i }Syntax: WHILE condition { commandlist } WHILE loop. Execute the comma-separated commands in the bracketedcommandlist while the condition is true. Conditions are the same as forIF commands.Syntax: OPEN mode filename For use with READ and WRITE commands. Open the local file in the specifiedmode: READ, WRITE, or APPEND. !READ and !WRITE mean to read from or writeto a system command rather than a file. Examples: OPEN READ oofa.txt OPEN !READ sort foo.barSyntax: ASKQ variablename promptExample: ASKQ %p { Password:} Issues the prompt and defines the variable to be whatever you type in.The characters that you type do not echo on the screen.Use braces to preserve leading and/or trailing spaces in the prompt.To include a question mark, precede it by backslash (\).Syntax: ASK variablename promptExample: ASK %n { What is your name\? } Issues the prompt and defines the variable to be whatever you type in.Use braces to preserve leading and/or trailing spaces in the prompt.To include a question mark, precede it by backslash (\).Syntax: DEFINE name [ definition ] Defines a macro or variable. Its value is the definition, taken literally.No expansion or evaluation of the definition is done. Thus if thedefinition includes any variable or function references, their names areincluded, rather than their values (compare with ASSIGN). If the definitionis omitted, then the named variable or macro is undefined. A typical macro definition looks like this: DEFINE name command, command, command, ... for example: DEFINE vax set parity even, set duplex full, set flow xon/xoff which defines a Kermit command macro called 'vax'. The definition is acomma-separated list of Kermit commands. Use the DO command to executethe macro, or just type its name, followed optionally by arguments. The definition of a variable can be anything at all, for example: DEFINE \%a Monday DEFINE \%b 3 These variables can be used almost anywhere, for example: ECHO Today is \%a SET BLOCK-CHECK \%bSyntax: ASSIGN variablename string.Example: ASSIGN \%a My name is \%b. Assigns the current value of the string to the variable (or macro).The definition string is fully evaluated before it is assigned, so thatthe values of any variables are contained are used, rather than theirnames. Compare with DEFINE. To illustrate the difference, try this: DEFINE \%a hello DEFINE \%x \%a ASSIGN \%y \%a DEFINE \%a goodbye ECHO \%x \%y This will print 'goodbye hello'.Syntax: DECREMENT variablename [ number ] Decrement (subtract one from) the value of a variable if the current valueis numeric. If the number argument is given, subtract that number instead. Examples: DECR \%a, DECR \%a 7, DECR \%a \%nSyntax: INCREMENT variablename [ number ] Increment (add one to) the value of a variable if the current value isnumeric. If the number argument is given, add that number instead. Examples: INCR \%a, INCR \%a 7, INCR \%a \%nSyntax: PAUSE [ number ]Example: PAUSE 3 Do nothing for the specified number of seconds; if no number given, onesecond. If interrupted from the keyboard, set FAILURE, otherwise SUCCESS.Syntax: MSLEEP [ number ]Example: MSLEEP 500 Do nothing for the specified number of milliseconds; if no number given,100 milliseconds.Syntax: ! [ command ] or RUN [ command ] or PUSH [ command ] Give a command to the local operating system's command processor, anddisplay the results on the screen. If the command is omitted, enter interactive mode; return to Kermitby exiting from the system's command parser. The command is usuallyEXIT or QUIT or LOGOUT.Syntax: TRANSMIT file The TRANSMIT command is used for sending single files to other computersthat don't have Kermit. Text files are sent a line at a time; binary filesare sent a character at a time. There is no guarantee that the othercomputer will receive the file correctly and completely. Before you startthe TRANSMIT command, you must put the other computer in data collectionmode, for example by starting a text editor. TRANSMIT may be interrupted byCtrl-C. Synonym: XMIT.Syntax: WAIT number [modem-signal(s)]Example: WAIT 5 \cd\cts Waits up to the given number of seconds for all of the specified signals.Sets FAILURE if signals do not appear in given time or if interrupted bytyping anything at the keyboard during the waiting period. Signals: \cd = Carrier Detect, \dsr = Dataset Ready, \cts = Clear To SendWarning: This command does not work yet, signals are ignored.Syntax: WRITE name text Writes the given text to the named log or file. The text text may includebackslash codes, and is not terminated by a newline unless you include theappropriate code. The name parameter can be any of the following: DEBUG-LOG ERROR (standard error) FILE (the OPEN WRITE, OPEN !WRITE, or OPEN APPEND file, see HELP OPEN) PACKET-LOG SCREEN (compare with ECHO) SESSION-LOG TRANSACTION-LOGSyntax: DIAL phonenumberExample: DIAL 7654321 Dial a number using an autodial modem. First you must SET MODEM, thenSET LINE, then SET SPEED. Then give the DIAL command, including the phonenumber, for example: DIAL 7654321 See also SET DIAL, SET MODEM, SET LINE, SET SPEED, REDIAL. The 'phonenumber' can also the name of an entry from your dialing directory,which is a plain text file, one entry per line: name phonenumber speed parity comments for example: e-mail 765-4321 2400 even My electronic mailbox The fields are separated by spaces, and all fields after the 'phonenumber'are optional. If the speed or parity are present, they replace your currentSET SPEED and SET PARITY settings. Specify your dialing directory file withthe SET DIAL DIRECTORY command.Syntax: APC text Echoes the text in the form of a VT220/320/420 Application Program Command. Use the APC command to send commands to MS-DOS Kermit 3.13 or later.Describes how to report C-Kermit bugs.Syntax: CHECK name Checks to see if the named feature is included in this version of C-Kermit. To list the features you can check, type "check ?".Syntax: CLEAR [ { DEVICE, INPUT, BOTH } ] Clears the communications device input buffer, the INPUT command buffer, or both. The default is BOTH.Syntax: COMMENT text Example: COMMENT - this is a comment. Introduces a comment. Beginning of command line only. Commands may also have trailing comments, introduced by ; or #.Your escape character is Ctrl-%c (ASCII %d, %s) DELSyntax: CD [ directoryname ] Change Working Directory, equivalent to UNIX cd command.Syntax: DECLARE arrayname[size] Example: DECLARE \&a[20] Declares an array of the given size. Array elements can be used just like any other variables.Syntax: DELETE filespec Delete a local file or files. RM is a synonym for DELETE.Syntax: DIRECTORY [ filespec ] Display a directory listing of local files.Syntax: DISABLE command Security for the C-Kermit server. Prevent the client Kermit program from executing the named REMOTE command, such as CD, DELETE, RECEIVE, etc.Syntax: [ DO ] macroname [ arguments ] Execute a macro that was defined by the DEFINE command. The word DO can be omitted. Trailing argument words, if any, are automatically assigned to the macro argument variables \%1, \%2, etc.Syntax: ECHO text Display the text on the screen, followed by a newline. The ECHO text may contain backslash codes. Example: ECHO \7Wake up!\7Syntax: ENABLE capability For use with server mode. Allow the client Kermit program access to the named capability, such as CD, DELETE, RECEIVE, etc. Opposite of DISABLE.Syntax: END [ number [ message ] ] Exit from the current macro or TAKE file, back to wherever invoked from. Number is return code. Message, if given, is printed.Syntax: ERROR Send an Error packet to the other Kermit to get it out of packet mode.Syntax: QUIT (or EXIT) Exit from the Kermit program, closing all open files and devices.Syntax: FINISH Tell the remote Kermit server to shut down without logging out.Syntax: GETOK prompt Print the prompt, make user type 'yes', 'no', or 'ok', and set SUCCESS or FAILURE accordingly.Syntax: GOTO label In a TAKE file or macro, go to the given label. A label is a word on the left margin that starts with a colon (:). Example: :oofa echo Hello! goto oofaSyntax: HANGUP Hang up the phone or network connection.%s, Copyright (C) 1985, 1993,Give a brief introduction to C-Kermit.Syntax: INPUT n [ text ] Example: INPUT 5 Login: Wait up to n seconds for the given text to arrive on the communication line. If no text, waits for any character. For use in script programs with IF FAILURE and IF SUCCESS. Also see SET INPUT.Redial the number given in the most recent DIAL commnd.Syntax: REINPUT n string Look for the string in the text that has recently been INPUT, set SUCCESS or FAILURE accordingly. Timeout, n, must be specified but is ignored.Syntax: RENAME oldname newname Change the name of file 'oldname' to 'newname'.Introduce a label, like :loop, for use with GOTO in TAKE files or macros. See GOTO.Syntax: MAIL filename address Send the file to the remote Kermit, which must be in RECEIVE or SERVER mode, and request that the remote host deliver the file as electronic mail to the given address. Example: MAIL BUG.TXT KERMIT@CUVMA Print news of new features since publication of "Using C-Kermit".Syntax: OUTPUT text Send the text out the currently selected line, as if you had typed it during CONNECT mode. The text may contain backslash codes. Example: OUTPUT help\13Syntax: PRINT file [ options ] Print the local file on a local printer with the given options.Syntax: PWD Print the name of the current working directory.Syntax: READ variablename Read a line from the currently open READ or !READ file into the variable (see OPEN).Remote commandSyntax: RETURN [ value ] Return from a macro. An optional return value can be given for use with with \fexecute(macro), which allows macros to be used like functions.Syntax: SUSPEND or Z Suspend Kermit. Continue Kermit with the appropriate system command, such as fg.ParameterDisplay current values of various items (SET parameters, variables, etc). Type SHOW ? for a list of categories.Syntax: SPACE Display disk usage in current device and/or directorySyntax: STATISTICS Display statistics about most recent file transferSyntax: STOP [ number [ message ] ] Stop executing the current macro or TAKE file and return immediately to the C-Kermit prompt. Number is a return code. Message printed if given.Syntax: TAKE filename Take Kermit commands from the named file. Kermit command files may themselves contain TAKE commands, up to a reasonable depth of nesting.Syntax: TYPE file Display a file on the screen. Pauses if you type Ctrl-S, resumes if you type Ctrl-Q, returns immediately to C-Kermit prompt if you type Ctrl-C.Syntax: VERSION Displays the program version number.Syntax: WHO [ user ] Displays info about the user.Help not available - %s %s %s Syntax: SET TRANSMIT parameter value Controls the behavior of the TRANSMIT command, used for uploading filesto computers that don't have Kermit programs. Parameters are: ECHO ON/OFF: Whether to echo text as it is being transmitted.EOF text: Text to send after end of file is reached.FILL number: ASCII value of character to insert into blank lines.LINEFEED ON/OFF: Transmit LF as well as CR at the end of each line. Normally, only CR is sent.LOCKING-SHIFT ON/OFF: Whether to use SO/SI for transmitting 8-bit data when PARITY is not NONE.PAUSE number: How many milliseconds to pause after transmitting each line (text mode), or each character (binary mode).PROMPT number: ASCII value of character to look for from host before sending next line, normally LF (10).Synonym: SET XMIT.Syntax: SET BACKGROUND { OFF, ON } SET BACKGROUND OFF forces prompts and messages to appear on your screeneven though Kermit thinks it is running in the background.Syntax: SET COMMAND BYTESIZE { 7, 8 } SET COMMAND BYTE 8 allows you to use an 8-bit (international) character setin the commands you type at the C-Kermit> prompt. 7 is the default.Syntax: SET CARRIER ON, AUTO, or OFF Attempts to control treatment of carrier on the communication device.ON means that carrier is required at all times except during the DIALcommand. OFF means that carrier is never required. AUTO (the default)means that carrier is required only during CONNECT.Syntax: SET ATTRIBUTES name ON or OFF Use this command to enable (ON) or disable (OFF) the transmission ofselected file attributes along with each file, and to handle or ignoreselected incoming file attributes, including: DATE: The file's creation date DISPOSITION: Unusual things to do with the file, like MAIL or PRINT LENGTH: The file's length SYSTEM-ID: Machine/Operating system of origin TYPE: The file's type (text or binary) You can also specify ALL to select all of them. Examples: SET ATTR DATE OFF SET ATTR LENGTH ON SET ATTR ALL OFFSyntax: SET INPUT parameter value The SET INPUT command controls the behavior of the INPUT command: SET INPUT CASE { IGNORE, OBSERVE }Tells whether alphabetic case is to be significant in string comparisons.This setting is local to the current macro or command file, and is inheritedby subordinate macros and take files. SET INPUT ECHO { ON, OFF }Tells whether to display arriving characters read by INPUT on the screen. SET INPUT SILENCE The maximum number to seconds of silence (no input at all) before the INPUTcommand times out, 0 for no maximum. SET INPUT TIMEOUT-ACTION { PROCEED, QUIT }Tells whether to proceed or quit from a script program if an INPUT commandfails. PROCEED (default) allows use of IF SUCCESS and IF FAILURE commands.This setting is local to the current macro or command file, and is inheritedby subordinate macros and take files.Syntax: SET TAKE parameter value Controls behavior of TAKE command. SET TAKE ECHO { ON, OFF } tells whether commands read from a TAKE fileshould be displayed on the screen. SET TAKE ERROR { ON, OFF } tells whether a TAKE command file should beautomatically terminated when a command fails. This setting is local tothe current command file, and inherited by subordinate command files.Syntax: SET TERMINAL parameter value SET TERMINAL BYTESIZE 7 or 8, to use 7- or 8-bit terminal charactersbetween C-Kermit and the remote computer or service during CONNECT. SET TERMINAL CR-DISPLAY { CRLF, NORMAL } to specify how incomingcarriage return characters are to be displayed on your screen. SET TERMINAL ECHO { LOCAL, REMOTE } to specify which side does theechoing during terminal connection. SET TERMINAL LOCKING-SHIFT { OFF, ON } tells C-Kermit whether to useShift-In/Shift-Out (Ctrl-O and Ctrl-N) to switch between 7-bit and 8-bitcharacters during CONNECT. OFF by default. SET TERMINAL NEWLINE-MODE { OFF, ON } tells whether to send CRLF when youtype CR during CONNECT mode. Type SHOW TERMINAL to see current terminal settings.Syntax: SET MACRO parameter value Controls the behavior of macros. SET MACRO ECHO { ON, OFF } tells whether commands executed from a macrodefinition should be displayed on the screen. SET MACRO ERROR { ON, OFF } tells whether a macro should be automaticallyterminated upon a command error. This setting is local to the currentmacro, and inherited by subordinate macros.Syntax: SET MODEM-DIALER name Type of modem for dialing remote connections. Selects the dialing protocol,such as HAYES, to be used by the DIAL command. Many modem dialing protocolsare supported; type SET MODEM ? for a list. DIRECT or NONE means a directconnection, with no modem at all. Also see HELP DIAL, HELP SET CARRIER.Syntax: SET PROMPT [ text ] Prompt text for this program, normally 'C-Kermit>'. May contain backslashcodes for special effects. Surround by { } to preserve leading or trailingspaces. If text omitted, prompt reverts to C-Kermit>. Prompt can includevariables like \v(dir) or \v(time) to show current directory or time.Syntax: SET WINDOW-SIZE number Specify number of window slots for sliding windows, the number of packetsthat can be transmitted before pausing for acknowledgement. The defaultis one, the maximum is 31. Increased window size may result in reducedmaximum packet length. Use sliding windows for improved efficiency onconnections with long delays. A full duplex connection is required.Syntax: SET REPEAT { COUNTS { ON, OFF }, PREFIX } SET REPEAT COUNTS turns the repeat-count compression mechanism ON and OFF. The default is ON.SET REPEAT PREFIX sets the repeat-count prefix character to the given code. The default is 126 (tilde).Syntax: SET RECEIVE parameter value Specify parameters for inbound packets: CONTROL-PREFIX number ASCII value of prefix character used for quoting control characters in packets that C-Kermit receives, normally 35 (number sign). Don't change this unless something is wrong with the other Kermit program.END-OF-PACKET number ASCII value of control character that terminates incoming packets, normally 13 (carriage return).PACKET-LENGTH number Maximum length packet the other Kermit should send.PADDING number Number of prepacket padding characters to ask for (normally 0).PAD-CHARACTER number ASCII value of control character to use for padding (normally 0).START-OF-PACKET number ASCII value of character that marks start of inbound packet.TIMEOUT number Number of seconds other Kermit should wait for a packet before sending NAK or retransmitting.Syntax: SET SEND parameter value Specify parameters for outbound packets. This command should be used onlyto override the normal negotiated parameters and is rarely needed: CONTROL-PREFIX number ASCII value of prefix character used for quoting control characters in packets that C-Kermit sends, normally 35 (number sign).END-OF-PACKET number ASCII value of control character to terminate an outbound packet, normally 13 (carriage return).PACKET-LENGTH number Maximum length packet to send, even if other Kermit asks for longer ones.PADDING number Number of prepacket padding characters to send.PAD-CHARACTER number ASCII value of control character to use for padding.START-OF-PACKET number ASCII value of character to mark start of outbound packet.TIMEOUT number Number of seconds to wait for a packet before sending NAK or retransmitting.Synonym: SET XFER Syntax: SET TRANSFER CANCELLATION { OFF, ON [ [ ] ] OFF disables remote-mode packet-mode cancellation from the keyboard.ON enables it. The optional is the control character to use forcancellation; the optional is how many consecutive occurrencesof the given control character are required for cancellation. Syntax: SET TRANSFER LOCKING-SHIFT { OFF, ON, FORCED } Tell whether locking-shift protocol should be used during file transferto achieve 8-bit transparency on a 7-bit connection. ON means to requestits use if PARITY is not NONE and to use it if the other Kermit agrees,OFF means not to use it, FORCED means to use it even if the other Kermitdoes not agree.Syntax: SET CASE { ON, OFF } Tells whether alphabetic case is significant in string comparisons done by INPUT, IF, and other commands. This setting is local to the current macro or command file, and inherited by subordinates.Syntax: SET INCOMPLETE { DISCARD, KEEP } Discard or Keep incompletely received files, default is DISCARD.Syntax: SET COUNT number Example: SET COUNT 5 Set up a loop counter, for use with IF COUNT. Local to current macro or command file, inherited by subordinate macros and command files.Syntax: SET DEBUG { SESSION, OFF } SESSION means display control and 8-bit characters symbolically during CONNECT mode.Syntax: SET DEFAULT directory Change directory. Equivalent to CD command.Syntax: SET DELAY number Number of seconds to wait before sending first packet after SEND command.Syntax: SET SUSPEND { OFF, ON } Disables SUSPEND command, suspend signals, and Z during CONNECT.Syntax: SET SCRIPT ECHO { OFF, ON } Disables/Enables echoing of SCRIPT command operation.Syntax: SET DUPLEX { FULL, HALF } During CONNECT: FULL means remote host echoes, HALF means C-Kermit does its own echoing.Syntax: SET ESCAPE number Decimal ASCII value for escape character during CONNECT, normally 28 (Control-\). Type the escape character followed by C to get back to the C-Kermit prompt.Syntax: SET OUTPUT PACING How many milliseconds to pause after sending each OUTPUT character. Syntax: SET LINE devicename or: SET PORT devicename Select communication device to use. Normally %s. If you SET LINE to other than %s, then Kermit will be in 'local' mode; SET LINE alone will reset Kermit to remote mode. To use the modem to dial out, first SET MODEM-DIALER (e.g., to HAYES), then SET LINE xxx, next issue the DIAL command, and finally CONNECT. Syntax: SET PARITY name Parity to use during terminal connection and file transfer: EVEN, ODD, MARK, SPACE, or NONE. Normally NONE.Syntax: SET QUIET {ON, OFF} Normally OFF. ON disables most information messages during interactive operation.Syntax: SET RETRY number How many times to retransmit a particular packet before giving up.Syntax: SET SESSION-LOG { BINARY, TEXT } If BINARY, record all CONNECT characters in session log. If TEXT, strip out carriage returns.Syntax: SET SPEED number Communication line speed for external tty line specified in most recent SET LINE command, in bits per second. Type SET SPEED ? for a list of possible speeds.Syntax: SET WILDCARD-EXPANSION { KERMIT, SHELL } KERMIT (the default) means C-Kermit expands filename wildcards in SEND and MSEND commands and incoming GET commands. SHELL means your shell does it.Not available yet - %s Syntax: REMOTE SET parameter valueExample: REMOTE SET FILE TYPE BINARY Ask the remote Kermit server to set the named parameter to the given value.Equivalent to typing the corresponding SET command directly to the otherKermit if it were in interactive mode.Syntax: REMOTE CD [ name ] Ask remote Kermit server to change its working directory or device. If the device or directory name is omitted, restore the default.Syntax: REMOTE DELETE filespec Ask the remote Kermit server to delete the named file(s).Syntax: REMOTE DIRECTORY [ filespec ] Ask the remote Kermit server to provide a directory listing of the named file(s) or if no file specification is given, of all files in the current directory.Syntax: REMOTE HELP Ask the remote Kermit server to list the services it provides.Syntax: REMOTE HOST command Send a command to the remote host computer in its own command language through the remote Kermit server.Syntax: REMOTE KERMIT command Send a command to the remote Kermit server in its own command language.Syntax: REMOTE LOGIN user password [ account ] Log in to a remote Kermit server that requires you login.Syntax: REMOTE LOGOUT Log out from a remote Kermit server to which you have previously logged in.Syntax: REMOTE PRINT filespec [ options ] Send the specified file(s) to the remote Kermit and ask it to have the file printed on the remote system's printer, using any specified options.Syntax: REMOTE SPACE [ name ] Ask the remote Kermit server to tell you about its disk space on the current disk or directory, or in the one that you name.Syntax: REMOTE TYPE file Ask the remote Kermit server to type the named file(s) on your screen.Syntax: REMOTE WHO [ name ] Ask the remote Kermit server to list who's logged in, or to give information about the named user.not working yet - %s www w w www#w*w8wFwKwOwRwVwYwawcw gwxlwpwvwzwwwhwwww<wwwww w wwwwww wwwww w w wwww!w&w-w3we8wm=wBwoFwsLwPwSwYw]w`wgwowtwywwwwwwwwwwwwwwwwwww ww$w)w4w@wFwMwTw\wawpw|wwprefixedunprefixedpacing123blank-free-2countsprefixchanges-speedmatches-speedautooffonoffonsession01101200150192002002400300360038400480050600759600fullhalfbytesizecollisiondisplayincompletenamestypewarningkeepnonexon/xoffbellcodecresclfnonexoffxonbinarytextkermitshellevenmarknoneoddspaceoffonlocaloffonremotediscardkeepechoerroroffonechoerrorechobytesizedisplaytimeoutcancellationlocking-shiftforcedoffoncharacter-setscyrillicdebugdialdynamic-memoryfullscreen-displayhebrewhelpif-commandjob-controlkanjilatin1latin2networkpushscript-commandserver-modeshow-commandtransmit %svailable Not aA CHECK: feature not available numeric key code?key code must be between 0 and %d key definition...Use SET SEND or SET RECEIVE instead. Type HELP SET SEND or HELP SET RECEIVE for more info. discard31010?Sorry, not available 1%d400autoCarrier wait timeout, seconds0Positive number0?A positive number, please bytesizebytesize for command characters, 7 or 87 ?The choices are 7 and 8 ?Sorry, debug log feature not enabled Number of seconds before starting to send5full%dDecimal ASCII code for CONNECT-mode escape characterxon/xoffnoneASCII value?Character must be in ASCII control range type of modemnonenoneProgram's command promptC-Kermit>Maximum retries per packet10?Retry limit must be greater than window size %d403%dinterval for server NAKs, 0 = none ?Specify a positive number, or 0 for no server NAKs %d404echotype of filetext ?Speed cannot be set for network connections Transmission rate for %s in bits per second?value required ?Sorry, you must SET LINE first ?Unsupported line speed - %ld %s, 75/1200 bps %s, %ld bps character-setASCII code for cancellation character3Cancel character must be in ASCII control range How many required to cause cancellation2Number must be 2 or greater onwho expands wildcardskermitNumber of sliding-window slots, 1 to 311%d406 Adjusting receive packet-length to %d for %d window slots OUTPUT command parameterpacingMilliseconds to pause between each OUTPUT character100control-character prefixing option?Internal error - malloc failure Numeric ASCII value of control character that needs NO prefix, or the word "all", or carriage return to complete the list Numeric ASCII value of control character that MUST BE prefixed, or the word "all", or carriage return to complete the listallala XON/XOFF characters 17, 19, 145, 147 not affected. SET FLOW NONE to transmit these characters unprefixed. ?Please specify a number or the word ALL ?Values allowed are: %d-31, 127-159, 255 Sorry, not while Xon/Xoff is in effect. repeat-count compression parameter(not implemented yet, nothing happens) ASCII value?Illegal value for prefix character Not working yet - %s control quote = %d, applied to (0 = unprefixed, 1 = prefixed): %3d: %d %3d: %d 127: %d %3d: %d %3d: %d 255: %d w"w&w*w.w2w6w:w>wBwFwJwNwRwVwZw^wbwfwBjwow tw|wwwwwwww wwwwww!w"w wwwwww ww w%w,w 3w:w?wEw"MwWw\wewpwyw wwwwwwwwww w ww wwww wwJanFebMarAprMayJunJulAugSepOctNovDecSunMonTueWedThuFriSatargcargscmdfilecmdlevelcmdsourcecountcpudatedaydirectoryexitstatusfilespecfsizehomehostinputincharincountlinelocalmacrondatendayntimeplatformprogramreturnspeedstatussystemtfsizetimettyfdversioncharactercodecontentsdefinitionevaluateexecutefilesindexlengthliterallowerlpadmaximumminimimnextfilereprepeatreplacereverserightrpadsubstringupperappendnew.kermrcmissing name in -ydebug.log?Can't open file %s Can't open device %s Can't condition line Can't condition line ^C... ?Can't transmit character Can't send buffer Name of packet log filepacket.logName of session log filesession.logName of transaction log filetransact.log ?Unknown log designator - %d DispositionnewTransaction Log:Communications Parameters: Host: %s Line: %s, speed: unknown75/1200%ld, mode: localremote, modem: %s, TCP/IP, TCP/IP, DECnet LAT, DECnet CTERM, DECnet, Named Pipe, telnet protocol Terminal bits: %d, p Parity: %s, duplex: half, full, flow: keepxon/xoffnonedtr/ctsrts/ctsdtr/cd%d, handshake: %d none offonautounknown Carrier: %s, timeout: %d sec, timeout: none, lockfile: %s Escape character: %d (^%c) No networks are supported in this version of C-Kermit (none) \{%d} Dial directory: %s (none) Dial hangup: %s, dial modem-hangup: %s onoffonoff Dial kermit-spoof: %sonoff, dial display: %s onoff Dial speed-matching: %sonoff, dial mnp-enable: %s onoff Dial init-string: Dial dial-command: Dial prefix: Dial timeout: %d sec0 (auto), Redial number: %s (none) File parameters: Attributes: onoff Names: %-12sconvertedliteral Type: textbinary?%-12s Packet Log: none Longest filename: %d Collide: %-12sunknown Session Log: none Longest pathname: %d Display: %-12snone%-12sserial%-12sfullscreen%-12scrt Transaction Log: none File Byte Size: %d, Incomplete Files: keepdiscard, Init file: %s Protocol Parameters: Send Receive Timeout (used=%2d):%7d*%8d Timeout (used=%2d):%7d%9d Server Timeout:%4d Padding: %11d%9d Block Check: blank-free-2 Block Check: %6d Pad Character:%11d%9d Delay: %6d Packet Start: %11d%9d Max Retries: %6d Packet End: %11d%9d 8th-Bit Prefix: '%c' Packet Length:%11d %8d Repeat Prefix: '%c' Maximum Length: %9d%9d Window Size:%7d set, %d used Buffer Size: %11d%9d Locking-Shift: forced %senableddisabled,%s%s not used %s,%s Most recent transaction -- files: %ld characters last file : %ld total file characters : %ld communication line in : %ld communication line out : %ld packets sent : %d packets received : %d damaged packets rec'd : %d timeouts : %d retransmissions : %d parity : %s (detected automatically) 8th bit prefixing : yes [%c] no locking shifts : %s yesno window slots used : %d of %d packet length : %d (send), %d (receive) compression : yes [%c] (%ld) no block check type used : blank-free-2 block check type used : %d elapsed time : %d sec transmission rate : 75/1200 bps transmission rate : %ld bps effective data rate : %ld cps efficiency (percent) : %d ?Can't condition line for INPUT ?malloc error 5 ?malloc error 6 ?\fexec() too deeply nested %d00%d0%d%d%d%d%d%dunknownUNIX%ld%d%ld%s/%dunknown%ld%dC-Kermit%ld%ldunknown%d%d10promptmacrofileunknown%d?definition is circular or too deep wwwwwwwwww ww www w&w,w2w:wEw Iw MwQwYwcdctsdsrri!read!writeappendreadwrite<=>backgroundcountdefinedequalerrorexistfailureforegroundlltlgtnotnumericsuccessVariable name?Variable name required ?Read file not open Prompt, enclose in { braces } to preserve leading and trailing spaces, precede question mark with backslash (\).{ Yes or no? }Please respond Yes or No Please respond. Type \? to include a question mark in your response. Variable name?Variable name required by amount1?Variable %s not defined or not numeric Macro or variable nameMacro or variable name?Variable name required Definition of variable?Argument vector array is read-only Definition of array elementDefinition of macro?%s failed ASSIGNDEFINE %s not in %s From dialing directory %s: %s=%s Can't set speed to %s ?No DIAL command given yet Number to dial or entry from dial directoryNumber to dial?You must specify a number to dial Directory/file specificationCK_DIR%s %sFile(s) to delete?A file specification is required %s %s%s - %sdeleted not ?ELSE doesn't follow IF command to be ignoredVariable name?Variable name required _forx initial valuefinal valueincrement1%d Command to execute?Unbalanced brackets ?Zero increment not allowed _forx_forx_forx?FOR macro definition gone! ?Incomplete FOR command %s,%s Numeric: %ld-%d To report C-Kermit bugs, send e-mail to: kermit@columbia.edu (Internet) KERMIT@CUVMA (EARN/CREN/BITNET) ...!uunet!columbia.edu!kermit (Usenet) Or write to: Kermit Development Columbia University 612 W 115 Street New York, NY 10025 USA Or call: +1 212 854-5126 (USA) Before reporting problems, please use the SHOW VERSION and SHOW FEATURES commands to get detailed program version and configuration information. seconds to wait1seconds to pause1milliseconds to sleep100modem signalFile to rename?Name of existing file required ?Please specify a single file New name?New name for file required ?Can't return from level %d mode?Mode required ?Read file already open File to read?Input filename required ?Please specify a single file ?Read file already open System command to read from?Command name required ?Write file already open System command to write to?Command name required Can't open process for writing: %s Name of local file to create?Filename required ?Write/Append file already open ?Not implementedCommand file ends prematurely in multiline GET OofaRemote filename missing in multiline GET MupeenMacro definition ends prematurely in multiline GET OofaRemote filename missing in multiline GET Mupeen Remote file specification: Name of remote file(s)(cancelled) Local name to store it under: Local file name(cancelled) ?Bad label syntax - '%s' ?Sorry, GOTO only works in a command file or macro ?Label '%s' not found ?Label '%s' not found ?Stack problem in GOTO %s ?Condition required Macro or variable nameFile?Filename required first word or variable name?Text required ?IF: strings too long second word or variable name?Text required ?IF: strings too long first number or variable name?Quantity required countversionargcsecond number or variable name?Quantity required countversionargcvariable name or constant?Quantity required command to be ignoredObject commandelse_xif_xif_xif?XIF macro gone! { \flit(if not goto bot) } Object command_while_while_while?WHILE macro definition gone! ?Can't allocate storage for WHILE commandr?TAKE files and/or DO commands nested too deeply TERMb/`Huvset parity mark, set dupl half, set handsh xon, set flow noneif def \%1 echo \%1, if not = \v(local) 0 hangup, stop 1_assign _for\v(cmdlevel) { _getargs,define \\\%1 \%2,:top,if \%5 \\\%1 \%3 goto bot,\%6,:inc,incr \\\%1 \%4,goto top,:bot,_putargs},def break goto bot, def continue goto inc,do _for\v(cmdlevel) \%1 \%2 \%3 \%4 { \%5 },_assign _for\v(cmdlevel)_assign _whi\v(cmdlevel) {_getargs,:inc,\%1,\%2,goto inc,:bot,_putargs},_def break goto bot, _def continue goto inc,do _whi\v(cmdlevel),_assign _whi\v(cmdlevel)_assign _if\v(cmdlevel) {_getargs,\%1,_putargs},do _if\v(cmdlevel),_assign _if\v(cmdlevel)cmdini: no memory for keymapcmdini: no memory for macrotabCan't allocate macro buffers!C-Kermit>ibm-linemodefatal_forx_xif_while\&@[%d]\&@[%d]/rr%s %sWarning: Last line of TAKE file lacks terminator ?Command too long, maximum length: %d. Command file terminated by error. Command error: macro terminated. ?Error in TAKE command file: %s Memory allocation failureLine too long or contains NUL charactersCommand ?Invalid - %s ?Invalid: %s Kermit command error in background executionOUTPUT error %s,%s Type ? or HELP for help ?addmmac malloc error: %s !addmmac internal error! ?addmac malloc error 2 addmac macro error 7: %s ?addmac malloc error 3: %s ?addmac malloc error 5: %s ?Packet log wasn't open ?Session log wasn't open ?Transaction log wasn't open ?Unexpected log designator - %d disabledenabled Versions: %s Numeric: %ld-%d %s for%s %s %s for%s %s %s %s %s %s %s %s %s Special features: Fullscreen file transfer display Control-character unprefixing Features not included: No debugging No network support No hardware flow control No character-set translation None Compiler options: TLOG XFRCAN CK_SPEED CMDDEP=%d UNIX ATT6300 HDBUUCP NOFILEH ATTSV CK_CURSES Press key: ?Error reading key Key code \%d => String: \{%d} Character: \%u%c \%u (self, no translation) Macro name, or carriage return to see them all%s - not found Macros: %d Function Status: GET %s SEND %s REMOTE CD/CWD %s REMOTE DELETE %s REMOTE DIRECTORY %s REMOTE HOST %s REMOTE SET %s REMOTE SPACE %s REMOTE TYPE %s REMOTE WHO %s BYE %s FINISH %s Server timeout: %d Server display: %s onoff %s SUCCESSFAILURE Command bytesize: %d bits Terminal bytesize: %d bits Terminal echo: %s localremote Terminal locking-shift: %s onoff Terminal newline-mode: %s onoff Terminal cr-display: %s crlfnormal CONNECT-mode escape character: %d (Ctrl-%c, %s) DEL Suspend: %s onoff \v(%s) = %s \f%s() Global variables: \%%%c No variables defined Macro arguments at level %d \%%%d = %s No macro arguments at top level Declared arrays: \&%c[%d] No arrays declared Cancellation: %sonoff %d %d Take Echo: %s OnOff Take Error: %s OnOff Macro Echo: %s OnOff Macro Error: %s OnOff Input Case: %s ObserveIgnore Input Echo: %s OnOff Input Silence: %d (seconds) Input Timeout: %s QuitProceed Output Pacing: %d (milliseconds) Script Echo: %s OnOff File type: %s binarytext Terminal echo: %s localremote Transmit EOF: none ^%c%c Transmit Fill: %d (fill character for blank lines) Transmit Fill: none Transmit Linefeed: %s on (send linefeeds too)off Transmit Prompt: %d (host line end character) Transmit Prompt: none Transmit Echo: %s onoff Transmit Locking-Shift: %s onoff Transmit Pause: %d milliseconds Escape character: Ctrl-%c (ASCII %d, %s) DEL, speed: unknown 75/1200 %ld offonautounknown Carrier: %s, timeout: %d sec, timeout: none %s modem signals: Character set translation is not supported in this version of C-Kermit Nothing to show... Line: %s, Modem: Communication device not yet selected with SET LINE Modem: couriercourier or sportster%s (%s) %s = (null definition)Attributes: %s OnOff Blocksize: %s OnOff Date: %s OnOff Disposition: %s OnOff Encoding (Character Set): %s OnOff Length: %s OnOff Type (text/binary): %s OnOff System ID: %s OnOff System Info: %s OnOffinvalid digit '%c' in number Invalid character '%c' in input +-|<>#@extra characters after expression %ldmissing right parenthesis operator unexpected ?Array reference too long - %s ?Not an array - %s ?Invalid format for array name - %s ?No closing bracket on array dimension - %s ?Array dimension or subscript must be numeric - %s ?Array dimension or subscript must be positive or zero - %s ?Not a variable name - %s ?Incomplete variable name - %s ?Only one character after '%%' in variable name, please ?Array subscript expected - %s ?Invalid array reference - %s ?Array not declared or subscript out of range %dMacros nested too deeply ?TAKE files and DO commands nested too deeply %0\flit(Name of local directory, or carriage return?Wildcards not allowed in directory name %s%sr       '/<FMT ^drw &4BPX^nv"  #%$    .6;Bdial-commanddirectorydisplayhangupinit-stringkermit-spoofmnp-enablemodem-hangupprefixspeed-matchingtimeoutechoeoffilllinefeedlocking-shiftpausepromptappendbackupdiscardno-supersedeoverwriterenameupdatecollisionnamesrecord-lengthtypeconvertedliteralbytesizecr-displayecholocking-shiftnewline-modecrlfnormalfixedundefinedcrtfullscreennoneoffonquietserialpacket-lengthtimeoutcontrol-prefixend-of-packetpacket-lengthpad-characterpaddingquotestart-of-packettimeoutattributesblock-checkfileincompletereceiveretryservertransferwindowalldatedispositionencodinglengthoffonsystem-idtypecasedefault-timeoutechosilencetimeout-actionproceedquitignoreobserveon ?Value required %s?Not a number: %s ?Sorry, %d is the maximum ?Value required ?Not in ASCII control range - %d Modem dialer initialization stringModem dialer telephone number prefixDialing command for modem, include "%s" to stand for phone number, for example, "set dial dial-command ATDT%s\13"?Dial-command must contain "%cs" for phone number. Seconds to wait for call completion0Name of dialing directory file?Wildcards not allowed r?Unexpected SET DIAL parameter Remote file parameter?Remote file parameter required File parameterfile byte size (7 or 8)8 ?The choices are 7 and 8 file transfer display styleTERMSorry, terminal type unknown: %s how to handle filenamesconverted%d301%dfile record length%d312type of filetext30010Filename collision actionbackup%d302?unexpected file parameter bytesize for terminal connection8 ?The choices are 7 and 8 which side echos during CONNECTremotenormalParameter for inbound packetsParameter for outbound packets?Remote receive parameter required ASCII value of control prefix?Illegal value for prefix character Decimal ASCII code for packet terminator13Sorry, the legal values are 0-31 Maximum number of characters in a packet90Sorry, 10 is the minimum %d401 Adjusting receive packet-length to %d for %d window slots Sorry, 10 is the minimum Adjusting packet size to %d for %d window slots Extended-length packets requested. Remember to SET BLOCK 2 or 3 for long packets. Code for packet-start character1How many padding characters for inbound packets0Decimal ASCII code for packet padding character0%dPacket timeout interval%d402Packet timeout intervalCharacters to send at end of file, Use backslash codes for control characters?Too many characters, %d maximum Numeric code for blank-line fill character0Numeric code for host's prompt character, 0 for none10Number of milliseconds to pause between binary characters or text lines during transmission0 Press the X or E key to cancel. ?Parameter name required Remote directory nameName of remote file(s) to delete?Name of remote file(s) required Remote directory or file specificationCommand for remote system?Remote host command required Command for remote Kermit?Remote Kermit command required User IDInternal error: malloc PasswordInternal error: malloc Account or carriage returnInternal error: malloc ?Disposition Attribute is Off Local file(s) to print on remote printer?Name of local file(s) required Options for remote print command?Option string too long Confirm, or remote directory nameRemote file specification?Remote filename required Remote user name, or carriage return?Not implemented - %s ?File specification required File Attribute packetsSorry, command not available 132101421014110135101331013910134101451014710?Not available Positive numberSeconds of inactivity before INPUT fails?Network connections not supported Communication device name?Timed out, no carrier. Try SET CARRIER OFF and SET LINE again, or else SET MODEM, SET LINE, and then DIAL. Sorry, access to lock denied: %s Sorry, access to device denied: %s Sorry, device is in use: %s Sorry, can't open connection: %sSorry, can't open connection: %s Sorry, can't open connection: %s T)X)\)`)d)h)l)p)t)w)z)})))))))))))))))))))))dNULSOHSTXETXEOTENQACKBELBSHTLFVTFFCRSOSIDLEDC1/XONDC2DC3/XOFFDC4NAKSYNETBCANEMSUBESCFSGSRSUSevenoddmarkspacenoneinvalidModem signals unavailable in this version of Kermit No modem control for this device Modem signals unavailable Carrier Detect (CD): %s OnOff Dataset Ready (DSR): %s OnOff Clear To Send (CTS): %s OnOff Ring Indicator (RI): %s OnOff Data Terminal Ready (DTR): %s OnOff Request to Send (RTS): %s OnOffFatal:HOSTmore? Y or space-bar for yes, N for no ^C...^C... suspend disabled %sJob control not supported %sStatus report: file type: binarytext file number size characters so far percent done block check: blank-free-2 block check compression 8th-bit prefixing locking shifts speed packet length packet length window slotsCancelling Batch Cancelling File Resending packet Type escape character (%s) followed by:X to cancel file, CR to resend current packetZ to cancel group, A for status reportE to send Error packet, Ctrl-C to quit immediately: Sending: Receiving: => Size: %ld, Type: Size: unknown, Type: binarytext File Percent Packet Bytes Done CPS Length%c%9ld%5ld%%%8ld%8ld %c%9ld %8ld%8ld [OK] [discarded] [interrupted] [skipped]Error: Refused: [incomplete]*** screen() called with bad status ***%s: %ld*** screen() called with bad object ***Protocol Error:Transaction Log Closedon_exit?T-Log string too long %s %ld %s %ld ?T-Log string too long [%s] ?T-Log string too long [%s] %ld ?T-Log string too long %s: %ld ?T-Log string too long %s %s ?T-Log string too long %s %s: %ld ?Invalid format for tlog() - %ld binarytext%02ld:%02ld:%02ld%s, %s%sCurrent Directory: %sRemote Host: %sCommunication Device: %sCommunication Speed: (network)75/1200%ldunknownParity: %sFile Type:File Size:Percent Done:Estimated Time Left:Window Slots:Packet Type:Packet Count:Packet Length:Packet Retry Count:Packet Block Check:Last Error:Last Message:<%s>X to cancel file, <%s>Z to cancel group, <%s> to resend packet<%s>E to send Error packet, or Ctrl-C to quit immediately.Sending:Receiving:File Name:%.54s..%s => %s => %.51s..%ld%sB%d%d%d%d of %d%d%c%ld%sDamaged PacketTimeout100%ldTransfer OKFile discardedTransfer interruptedFile skipped%sRefused, %sRefusedIncomplete*** screen() called with bad status ***Files: %ld, Total Bytes: %ld, %ld cpsFiles: %ld, Total Bytes: %ld Elapsed Time: %s? %s%s*** screen() called with bad function code ***-l and -b required-a without -s, -r, or -gunredirected -k can only be used in local modeNo commands given for -Cconflicting actionsconflicting actionsconflicting actionsconflicting actionsconflicting actionsinvalid argument bundling after -s-No files for -s-s: too many -'sinvalid mixture of filenames and '-' in -ssending from terminal not allowedconflicting actionsinvalid argument bundling after -gmissing filename for -ginvalid argument bundling after -amissing name in -ainvalid argument bundling after -ymissing filename in -yinvalid argument bundling after -l or -jcommunication line device name missing/dev/ttycan't open deviceinvalid argument bundlingmissing baudunsupported transmission rateinvalid argument bundling after -mmodem type missingunknown modem typeinvalid argument bundling after -emissing lengthUnsupported packet lengthinvalid argument bundlingmissing or bad window sizeUnsupported packet lengthinvalid argument bundlingmissing parityinvalid parityinvalid argument, type 'kermit -h' for helpV@ Bx@z@*|@.~@@_@7@5@6@7@Q@@@&@@\@@@*@@@G@G@;@@@(@A A2 AOA A< A@'A0+A .A 3A*;A =A DAHGAHKAOA QA TA XAV^A/cA+jAoAqA-tAwA9AA[AAAAAA A]APAPA]APAA^AADAAA0AAAAA3ABBE BBSB8 B'B.B&5BCBIB'BABJB%BNBXBYBTBUw!#;:@BBBB"C3C3 C3CC%C.-C72C6:CLC'RCTCWC]C4eCkC0pCwCCC C C C C C C*CCC@C+CCDCCCC?D DDDA%D*D#1D1=DCD<KD(PD!YD%bD/kD;~D$D/5DDDDDDDDDD DDDDDDDDEEEE'E.E:EEE UEZEhEuEEEEEEEEEEEE FFFF#F,F1F;FCFGFNF\FdFoFxF F F FF FFF FFFFF FFFFFF F F F User Interface 5A(103), 26 Jun 93!#:@apcasgaskaskqassignbugbyeccatcdcheckclearclosecommentconnectcwddcldeclaredecrementdefinedeletedialdirectorydisabledoe-packetechoelseenableendexexitextprocffinishfoforfotggegetgetokgotohanguphelpiifinincrementinputintroductionlloglsmailmanmgetmpausemsmsendmsleepmputmvnewsoopenoutputpausepopprintpupushputpwdquitrreadreceiveredialreinputremoterenamereplayreturnrmrunsscriptsendserversetshowsleepspspaspacespawnstatisticsstopsuspendtaketransmittypeversionwaitwhilewhowritexifxmitz_assign_define_getargs_putargsnookyesattributesbbabackgroundbaudblock-checkcarriercasecommandcontrol-charactercountddedebugdefaultdelaydialduplexescape-characterfileflow-controlhandshakeincompleteiininputkeyllinelocal-echomacromodem-dialeroutputparityportpromptquietreceiverepeatretry-limitscriptsendserversession-logspeedsuspendtaketerminaltransfertransmitwildcard-expansionwindow-sizexmitcdcwddeletedirectoryhelphostkermitloginlogoutprintsetspacetypewhopacketssessiontransactionsappend-filedebug-logerrorfilepacket-logscreensession-logsys$outputtransaction-logbothdevice-bufferinput-bufferappend-filepacket-logread-filesession-logtransaction-logwrite-fileargumentsarraysattributescharacter-setscommunicationscontrol-prefixingcountdefaultdialescapefeaturesfilefunctionsglobalskeymacrosmodem-signalsnetworkparametersprotocolscriptsserverstatusterminaltransmitvariablesversionsxmitallbyecdcwddeletedirectoryfinishgethostsendsetspacetypewho buffer(s) to clearbothText of comment lineWhich log or file to close?You must say which file or log Array name?Array name required ?Declare failed Server function to enableServer function to disable?Name of server function required optional return valueoptional return value ?No macros defined macro?Macro name required optional argumentsText to be echoedApplication Program Command text%c_%s%c\%s Text to be outputFile to print?A file specification is required ?Wildcards not allowed Local print command options, or carriage returnexit status codeName of remote file(s), or carriage returnC-Kermit commandhelp ?Invalid - %s label?Label name required %dseconds to wait for inputMaterial to be input?Input timed out ?Reinput failed label?Label name required What to log?Type of log required expect-send expect-send ...Name under which to store the file, or CRRemote Kermit server command?You must specify a command for the remote server File(s) to send?A file specification is required Name to send it with?Disposition Attribute is Off Address to mail to?Address required ?Option string too long Names of files to send, separated by spaces?A file specification is required Parameter?You must specify a parameter to set ?More fields required System command to executeparametersConfirm for current disk, or specify a disk device or directory%s %sexit status code0Message to print%s ?Take files nested too deeply C-Kermit command file?A file name is required ?Wildcards not allowed in command file name File to transmit?Name of an existing file ?Only a single file may be transmitted File to type?Name of an existing file ?A single file please CK_TYPE%s %scmdlvl = %d, tlevel = %d, maclvl = %d %s Call me from inside a macro and I'll dump the argument stackMacro level: %d, ARGC = %d %7d %2d: %7s(none) %s,%s Numeric: %ld-%d user nameCK_WHO%s %sto file or log?Write to what? text%s%s ?File or log not open rO3RJRfR|RRRRRSS5SXSySSS TDTCONNECT Command for UNIX, 5A(054) 26 May 93Sorry, you must SET LINE first Sorry, you must SET SPEED first Sorry, can't open %sConnecting to %s, speed %ld. The escape character is Ctrl-%c (ASCII %d, %s) DELType the escape character followed by C to get back, or followed by ? to see other options. (Session logged to %s, %s) binarytextDebugging Display...) Sorry, can't condition console terminal Sorry, can't reopen %sSorry, Can't condition communication line Can't create keyboard fork Communications disconnect (Back at %s) local UNIX system Can't send character(Back at %s)local UNIX system ?setuid error - fatal Communications disconnect Can't read character ? for this message 0 (zero) to send a null B to send a BREAK L to send a Long BREAK H to hangup and close the connection Q to hangup and quit Kermit S for status ! to push to local shell Z to suspend \ backslash code: \nnn decimal character code \Onnn octal character code \Xhh hexadecimal character code terminate with carriage return. Type the escape character again to send the escape character, or press the space-bar to resume the CONNECT command. Press C to return to the C-Kermit prompt, or:Command> Hanging up Connected %s %stothrough, speed %ldTerminal bytesize: %d, Command bytesize: %d, Parity: noneevenoddspacemarkTerminal echo: %slocalremoteLogging to: Error resuming CONNECT session ERROR WRITING SESSION LOG, LOG CLOSED!>[^[f[r[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[([ [[[[[[[[\ \ \ \\\\\\\\"\#\$\&\(\)\*\.\/\0\3\5\6\7\;\<\(=\ @\E\I\J\K\LR\V\g [\]\`\b\e\g\l\m\#n\p\{\|\}\~\L\\g2\\,\\\\\\#\\2\\\\L\\\\\\\\\\\\\\L\\g\\,\\\]] ]# ] ]]]]] ]!]"]#]$]%])]*]<+],]/]7]8]9]B]C]#D]H]dJ]L]M]R]S]#T]V]f]j]k]l]Ls]w]g<]]d]]]]PL]]g8VU VfVVVVWzWWWX2X`XXXXYFYtYYLW]]]]]]]]]^^^*^1^ =^ I^ O^[^d^i^ p^|^ ^^^^^ ^^^^^^^^_Dial Command, 5A(050) 26 Jun 93UnknownTrailBlazerTrailBlazer-PlusT1000T1500T1600T2000T2500T3000QblazerWorldBlazer DIAL%s ,+at%s %s ,:VALCRN%s BbPpTt XYR D '%s' =%s=%s#=W%s!,:HUP VALCRN%s +++HUP % $D :T%s ,ATQ0S2=43 ATD%s +++ATQ0H0 >k :%s Kk *D ?%s %s ,ATQ0S2=43 OK ATTD%s +++ATQ0H0 % $K Number to call: %s , CDS >%s MODIFY?CALL %s ,!@ !d%s ,ATQ0S2=43X4&M4 OK ATD%s +++ATQ0H0 ,AAAAATQ0X1S12=50 S2=43 I OK ATD%s +++ATQ0H0 attdtdmattisnattmodematt7300ccitt-v25biscermetekconcordcourierdf03-acdf100-seriesdf200-seriesdigitel-dt22directgdc-212a/edgendatacommhayeshst-couriermicrocomnonepenrilpep-telebitracalvadicrolmslow-telebitsportstertelebitunknownusrobotics-212av32-telebitv42-telebitventelUnknownTimeoutInterruptModemInitialize Warning: speed change to %ld failed. Speed changed to %ld. ATI3 T1600T3000WorldVersion BTBSATBRMDCT1500Please SET HOST first, and then SET MODEM Sorry, you must SET MODEM first Sorry, you must SET LINE or SET HOST first Sorry, you must SET SPEED first %s%sSorry, can't open %sSorry, can't reopen %sSorry, Can't condition communication line Try 'set line %s' again Dialing: %s Via modem server: %s, modem-dialer: %s (unknown) Device: %s, modem-dialer: %s(unknown), speed: %ld , speed: (unknown) Dial timeout: %d seconds To cancel: type your interrupt character (normally Ctrl-C). Sorry, Can't hang up communication device Try 'set line %s' again %s failure while handling failure. DIAL TIMEOUT interval expired. Dialing interrupted. Call failed (""). Can't initialize modem. ATS7=%d%c962961963972968966967964969965971123960Telebit model: %s ATS7=%d S48=%d S50=0 S58=2 S68=255 ATS7=%d S48=%d S50=0 S68=255 ATS54=3 ATX2 S61=0 S63=0 S50=0 S95=2 S97=1 S98=3 S106=1S180=2V.42 not supported by this Telebit model S95=2S95=0S180=3S180=0standardS50=0 S110=1S50=0 S190=1 S191=7S50=0300/1200/2400 BaudS50=3V.32S50=6V.32 not supported by this Telebit model. PEPS50=255 S190=1 S191=7S50=255 S110=1S50=255PEP not supported by this Telebit model. Kermit SpoofAT%s %s S111=%d S112=%d AT%s %s No Kermit SpoofKermit Spoof not supported by Qblazer No Kermit SpoofAT%s %s %s S111=044445AT&M4&K1 AT&M0&K0 No ConnectionBusyNot connectedNot ConnectedNo dial toneNo Dial ToneNo answerNo AnswerAnsweredConnectedANSWEREDBUSYDISCONNECTNO ANSWERWRONG ADDRESSANSWEREDBUSYCHECK OPTIONSDISCONNECTEDDENIEDVALWarning: No Carrier CNXINVINVCFIABAB: Timed outCBCB: Local DCE BusyETET: BusyNSNS: Number not storedNTNT: No answerRTRT: Ring tonePVPV: Parameter value errorPSPS: Parameter syntax errorMSMS: Message syntax errorCUCU: Command unknownFCFC: Forbidden callINCINC: Incoming callDLCDLC: Delayed callAU 1 ANERAttachedBusyDisconnectedErrorNo answerNo dial toneSpeed:ON LINENO CONNECTCONNECT Can't change speed to %ld Speed changed to %ld CONNECT FAST/KERMFAST/KERM RRINGRINGINGDIALINGCONNECTNO CARRIERNO DIALTONENO DIAL TONEBUSYNO ANSWERVOICERINGERROROKBUSYNO RINGON LINEFAILED CALLCALLINGCOMPLETEFAILEDNOT AVAILABLELACKS PERMISSIONNOT A DATALINEINVALID GROUP NAMEBUSYABANDONDEDDOES NOT ANSWERINVALID DATA LINE NUMBERONLINE!Online!BUSYDEAD PHONEBusyINITIATINGBUSYCALL FAILEDNO CONNECTBUSYNO DIALTONECOMMAND ERRORIN USECONNECT Local phone is ringing! No Carrier. Modem Command Error. No Dialtone. Busy. No Answer. CONNECT 1200/75 - Not support by C-Kermit Ringing... Dialing... No Prompttone. RELIABLELAPM COMPRESSED Call complete. VALOK ERROR at at AT AT Modem hangup OK Warning: modem hangup failed Hangup OK Hangup skipped Hangup error Hangup skipped jScript Command, 5A(016) 26 Jun 93expecting sequencegot it (null sequence)received sequence: returning with got-it codesending sequence EOTBREAK\b\B{BREAK}Sorry, can't open %sExecuting SCRIPT through %s, speed %ld. SCRIPT string: Sorry, Can't condition communication line Script successful. Script successful.Sorry, script failed Script failed|lNetwork support, 5A(019) 8 Jun 93llSorry, I don't know how to deal with your '%s' terminal. Sorry, I need to know a more specific terminal type than '%s'. unknown downupleftrighthomebackspacef0f1f2f3f4f5f6f7f8f9dlildciceiccleareoseolsfsrnpageppagestabctabcatablla1a3b2c1c32Kn,X` %KTERMunknownTERMINFO/usr/lib/terminfo/a//usr/lib/terminfo/ . /usr/lib/terminfo/ . No such terminal: corrupted term entry term entry too long LINESCOLUMNSppppppppppppppppppppppppppppppppppppppppqqqqq q qqqqqqqqqq q"q$q&q(q*q,q.q0q2q4q6q8q:qq@qBqDqFqHqJqLqNqPqRqTqVqXqZq\q^q`qbqdqfqhqjqlqnqpqrqtqvqxqzq|q~qqqqqqqqqqqqqqqqqqqqqqqqq^@^A^B^C^D^E^F^G^H^I^J^K^L^M^N^O^P^Q^R^S^T^U^V^W^X^Y^Z^[^\^]^~^_ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~^?Hash table full in dispcalcBad call to _showstring, first %lx, last %lx, diff %dpcx null argbad char after %3bad char after %2bad parm numbermissing closing quotemissing closing bracebad % sequenceno matching ENDIF5MS7) rrDɇunknownPackaged for USG UNIX 6.0, 3/6/83/dev/ttyPF$s(sM:/ESTEDTDay Mon 00 00:00:00 1900 SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecTZpwdr/etc/utmp/etc/passwdrrUnknown error: xttttttttuu$u7uIuZuluxuuuuuuuuu vv0v?vNvfvsvvvvvvvvw/w>wLwewwww.Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo child processesNo more processesNot enough spacePermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument out of domainResult too largeNo message of desired typeIdentifier removedChannel number out of rangeLevel 2 not synchronizedLevel 3 haltedLevel 3 resetLink number out of rangeProtocol driver not attachedNo CSI structure availableLevel 2 haltedDeadlock condition if locked/bin/shsh-c??GGA>???/etc/utmp/dev/ 00000000000000000000-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ ((((( H nF 7yACחA@Y@$@@C$@$@$@$@$@?$@$@̇Їˇˇ{ˇ